Jun 30 23:34:32 np0000004054 sudo[2312]: pam_unix(sudo:session): session closed for user root Jun 30 23:34:32 np0000004054 sudo[2330]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-akhycnkbuqdqgowmagygigviupevzvol ; /usr/bin/python3' Jun 30 23:34:32 np0000004054 sudo[2330]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:34:32 np0000004054 sudo[2330]: pam_unix(sudo:session): session closed for user root Jun 30 23:34:32 np0000004054 sudo[2339]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-gofuoljzccittkqcaqdvnsdokwdnloir ; /usr/bin/python3' Jun 30 23:34:32 np0000004054 sudo[2339]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:34:32 np0000004054 sudo[2339]: pam_unix(sudo:session): session closed for user root Jun 30 23:34:37 np0000004054 sudo[2353]: ubuntu : PWD=/home/ubuntu ; USER=stack ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-elvluyfyeugtxztgzllobllntggkavle ; /usr/bin/python3' Jun 30 23:34:37 np0000004054 sudo[2353]: pam_unix(sudo:session): session opened for user stack(uid=1002) by ubuntu(uid=1000) Jun 30 23:34:37 np0000004054 sudo[2353]: pam_unix(sudo:session): session closed for user stack Jun 30 23:34:38 np0000004054 sudo[2408]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-brdcsxuskiofrdhnbefcysxlsiceqojy ; /usr/bin/python3' Jun 30 23:34:38 np0000004054 sudo[2408]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:34:38 np0000004054 sudo[2408]: pam_unix(sudo:session): session closed for user root Jun 30 23:34:38 np0000004054 sudo[2413]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-ohexyphnkmsoeymomkfwtmvnzjxqidip ; /usr/bin/python3' Jun 30 23:34:38 np0000004054 sudo[2413]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:34:39 np0000004054 sudo[2413]: pam_unix(sudo:session): session closed for user root Jun 30 23:34:39 np0000004054 sudo[2418]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-tbsirrijvobtpxbzegehsrngflqleelp ; /usr/bin/python3' Jun 30 23:34:39 np0000004054 sudo[2418]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:34:40 np0000004054 sudo[2418]: pam_unix(sudo:session): session closed for user root Jun 30 23:34:40 np0000004054 sudo[2556]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-jnepyxjafprpaavdcltqrmcsykincugw ; /usr/bin/python3' Jun 30 23:34:40 np0000004054 sudo[2556]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:34:40 np0000004054 sudo[2556]: pam_unix(sudo:session): session closed for user root Jun 30 23:34:40 np0000004054 sudo[2603]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-blgzvhcjqfozvibpgzrdfyxnusbwzgyt ; /usr/bin/python3' Jun 30 23:34:40 np0000004054 sudo[2603]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:34:41 np0000004054 sudo[2603]: pam_unix(sudo:session): session closed for user root Jun 30 23:34:41 np0000004054 sudo[2650]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-tbaruaeduphvyrryraiseigheymyqzeq ; /usr/bin/python3' Jun 30 23:34:41 np0000004054 sudo[2650]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:34:41 np0000004054 sudo[2650]: pam_unix(sudo:session): session closed for user root Jun 30 23:34:41 np0000004054 sudo[2697]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-vtlqafqwskfaquzkrqwodownljpvximr ; /usr/bin/python3' Jun 30 23:34:41 np0000004054 sudo[2697]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:34:42 np0000004054 sudo[2697]: pam_unix(sudo:session): session closed for user root Jun 30 23:34:43 np0000004054 sudo[2745]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-qeulkxqufpuwbcnmuglpaxgavtajfkbi ; /usr/bin/python3' Jun 30 23:34:43 np0000004054 sudo[2745]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:34:43 np0000004054 sudo[2745]: pam_unix(sudo:session): session closed for user root Jun 30 23:34:45 np0000004054 sudo[2813]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-xkuxwwaudsjdubcnahgktehjilauhaga ; /usr/bin/python3' Jun 30 23:34:45 np0000004054 sudo[2813]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:35:17 np0000004054 sudo[2813]: pam_unix(sudo:session): session closed for user root Jun 30 23:35:18 np0000004054 sudo[7888]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-xhceovclqcvnfbgbxokutmzzijeppwtm ; /usr/bin/python3' Jun 30 23:35:18 np0000004054 sudo[7888]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:35:18 np0000004054 sudo[7888]: pam_unix(sudo:session): session closed for user root Jun 30 23:35:19 np0000004054 sudo[7896]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-llzumxukntlmaghujlqnefegjebpoqyg ; /usr/bin/python3' Jun 30 23:35:19 np0000004054 sudo[7896]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:35:19 np0000004054 sudo[7896]: pam_unix(sudo:session): session closed for user root Jun 30 23:36:30 np0000004054 kernel: pci 0000:07:00.0: [1af4:1041] type 00 class 0x020000 PCIe Endpoint Jun 30 23:36:30 np0000004054 kernel: pci 0000:07:00.0: BAR 1 [mem 0x00000000-0x00000fff] Jun 30 23:36:30 np0000004054 kernel: pci 0000:07:00.0: BAR 4 [mem 0x00000000-0x00003fff 64bit pref] Jun 30 23:36:30 np0000004054 kernel: pci 0000:07:00.0: ROM [mem 0x00000000-0x0007ffff pref] Jun 30 23:36:30 np0000004054 kernel: pci 0000:07:00.0: ROM [mem 0xfe000000-0xfe07ffff pref]: assigned Jun 30 23:36:30 np0000004054 kernel: pci 0000:07:00.0: BAR 4 [mem 0xc160000000-0xc160003fff 64bit pref]: assigned Jun 30 23:36:30 np0000004054 kernel: pci 0000:07:00.0: BAR 1 [mem 0xfe080000-0xfe080fff]: assigned Jun 30 23:36:30 np0000004054 kernel: virtio-pci 0000:07:00.0: enabling device (0000 -> 0002) Jun 30 23:36:30 np0000004054 kernel: virtio_net virtio5 enp7s0: renamed from eth0 Jun 30 23:36:42 np0000004054 kernel: pci 0000:08:00.0: [1af4:1041] type 00 class 0x020000 PCIe Endpoint Jun 30 23:36:42 np0000004054 kernel: pci 0000:08:00.0: BAR 1 [mem 0x00000000-0x00000fff] Jun 30 23:36:42 np0000004054 kernel: pci 0000:08:00.0: BAR 4 [mem 0x00000000-0x00003fff 64bit pref] Jun 30 23:36:42 np0000004054 kernel: pci 0000:08:00.0: ROM [mem 0x00000000-0x0007ffff pref] Jun 30 23:36:42 np0000004054 kernel: pci 0000:08:00.0: ROM [mem 0xfde00000-0xfde7ffff pref]: assigned Jun 30 23:36:42 np0000004054 kernel: pci 0000:08:00.0: BAR 4 [mem 0xc140000000-0xc140003fff 64bit pref]: assigned Jun 30 23:36:42 np0000004054 kernel: pci 0000:08:00.0: BAR 1 [mem 0xfde80000-0xfde80fff]: assigned Jun 30 23:36:42 np0000004054 kernel: virtio-pci 0000:08:00.0: enabling device (0000 -> 0002) Jun 30 23:36:42 np0000004054 kernel: virtio_net virtio6 enp8s0: renamed from eth0 Jun 30 23:37:21 np0000004054 sudo[7981]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-lwqzkxcrwimcljckpyoegkzajoqtlwne ; /usr/bin/python3' Jun 30 23:37:21 np0000004054 sudo[7981]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:37:21 np0000004054 sudo[7981]: pam_unix(sudo:session): session closed for user root Jun 30 23:37:21 np0000004054 sudo[7990]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-uctgykkyderkznzltuzosslvcuegxzqi ; /usr/bin/python3' Jun 30 23:37:21 np0000004054 sudo[7990]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:37:22 np0000004054 sudo[7990]: pam_unix(sudo:session): session closed for user root Jun 30 23:37:22 np0000004054 sudo[7999]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-sqavpviydhmryczjwgtxspxfygsvvzxu ; /usr/bin/python3' Jun 30 23:37:22 np0000004054 sudo[7999]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:37:23 np0000004054 sudo[7999]: pam_unix(sudo:session): session closed for user root Jun 30 23:37:23 np0000004054 sudo[8054]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-nrakcigmmttimzslqnkobthgmlrpuclb ; /usr/bin/python3' Jun 30 23:37:23 np0000004054 sudo[8054]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:37:24 np0000004054 kernel: virtio_net virtio5 iscsi0: renamed from enp7s0 Jun 30 23:37:24 np0000004054 kernel: virtio_net virtio6 iscsi1: renamed from enp8s0 Jun 30 23:37:24 np0000004054 kernel: 8021q: adding VLAN 0 to HW filter on device iscsi1 Jun 30 23:37:24 np0000004054 kernel: 8021q: adding VLAN 0 to HW filter on device iscsi0 Jun 30 23:37:24 np0000004054 sudo[8054]: pam_unix(sudo:session): session closed for user root Jun 30 23:38:02 np0000004054 kernel: pci 0000:09:00.0: [1af4:1041] type 00 class 0x020000 PCIe Endpoint Jun 30 23:38:02 np0000004054 kernel: pci 0000:09:00.0: BAR 1 [mem 0x00000000-0x00000fff] Jun 30 23:38:02 np0000004054 kernel: pci 0000:09:00.0: BAR 4 [mem 0x00000000-0x00003fff 64bit pref] Jun 30 23:38:02 np0000004054 kernel: pci 0000:09:00.0: ROM [mem 0x00000000-0x0007ffff pref] Jun 30 23:38:02 np0000004054 kernel: pci 0000:09:00.0: ROM [mem 0xfdc00000-0xfdc7ffff pref]: assigned Jun 30 23:38:02 np0000004054 kernel: pci 0000:09:00.0: BAR 4 [mem 0xc120000000-0xc120003fff 64bit pref]: assigned Jun 30 23:38:02 np0000004054 kernel: pci 0000:09:00.0: BAR 1 [mem 0xfdc80000-0xfdc80fff]: assigned Jun 30 23:38:02 np0000004054 kernel: virtio-pci 0000:09:00.0: enabling device (0000 -> 0002) Jun 30 23:38:02 np0000004054 kernel: virtio_net virtio7 enp9s0: renamed from eth0 Jun 30 23:38:14 np0000004054 kernel: pci 0000:0a:00.0: [1af4:1041] type 00 class 0x020000 PCIe Endpoint Jun 30 23:38:14 np0000004054 kernel: pci 0000:0a:00.0: BAR 1 [mem 0x00000000-0x00000fff] Jun 30 23:38:14 np0000004054 kernel: pci 0000:0a:00.0: BAR 4 [mem 0x00000000-0x00003fff 64bit pref] Jun 30 23:38:14 np0000004054 kernel: pci 0000:0a:00.0: ROM [mem 0x00000000-0x0007ffff pref] Jun 30 23:38:14 np0000004054 kernel: pci 0000:0a:00.0: ROM [mem 0xfda00000-0xfda7ffff pref]: assigned Jun 30 23:38:14 np0000004054 kernel: pci 0000:0a:00.0: BAR 4 [mem 0xc100000000-0xc100003fff 64bit pref]: assigned Jun 30 23:38:14 np0000004054 kernel: pci 0000:0a:00.0: BAR 1 [mem 0xfda80000-0xfda80fff]: assigned Jun 30 23:38:14 np0000004054 kernel: virtio-pci 0000:0a:00.0: enabling device (0000 -> 0002) Jun 30 23:38:14 np0000004054 kernel: virtio_net virtio8 enp10s0: renamed from eth0 Jun 30 23:38:27 np0000004054 kernel: pci 0000:0b:00.0: [1af4:1041] type 00 class 0x020000 PCIe Endpoint Jun 30 23:38:27 np0000004054 kernel: pci 0000:0b:00.0: BAR 1 [mem 0x00000000-0x00000fff] Jun 30 23:38:27 np0000004054 kernel: pci 0000:0b:00.0: BAR 4 [mem 0x00000000-0x00003fff 64bit pref] Jun 30 23:38:27 np0000004054 kernel: pci 0000:0b:00.0: ROM [mem 0x00000000-0x0007ffff pref] Jun 30 23:38:27 np0000004054 kernel: pci 0000:0b:00.0: ROM [mem 0xfd800000-0xfd87ffff pref]: assigned Jun 30 23:38:27 np0000004054 kernel: pci 0000:0b:00.0: BAR 4 [mem 0xc0e0000000-0xc0e0003fff 64bit pref]: assigned Jun 30 23:38:27 np0000004054 kernel: pci 0000:0b:00.0: BAR 1 [mem 0xfd880000-0xfd880fff]: assigned Jun 30 23:38:27 np0000004054 kernel: virtio-pci 0000:0b:00.0: enabling device (0000 -> 0002) Jun 30 23:38:27 np0000004054 kernel: virtio_net virtio9 enp11s0: renamed from eth0 Jun 30 23:39:02 np0000004054 kernel: scsi 0:0:0:1: Direct-Access QEMU QEMU HARDDISK 2.5+ PQ: 0 ANSI: 5 Jun 30 23:39:02 np0000004054 kernel: sd 0:0:0:1: Power-on or device reset occurred Jun 30 23:39:02 np0000004054 kernel: sd 0:0:0:1: LUN assignments on this target have changed. The Linux SCSI layer does not automatically remap LUN assignments. Jun 30 23:39:02 np0000004054 kernel: sd 0:0:0:1: Attached scsi generic sg1 type 0 Jun 30 23:39:02 np0000004054 kernel: sd 0:0:0:1: [sdb] 482344960 512-byte logical blocks: (247 GB/230 GiB) Jun 30 23:39:02 np0000004054 kernel: sd 0:0:0:1: [sdb] Write Protect is off Jun 30 23:39:02 np0000004054 kernel: sd 0:0:0:1: [sdb] Mode Sense: 63 00 00 08 Jun 30 23:39:02 np0000004054 kernel: sd 0:0:0:1: [sdb] Write cache: enabled, read cache: enabled, doesn't support DPO or FUA Jun 30 23:39:02 np0000004054 kernel: sd 0:0:0:1: [sdb] Attached SCSI disk Jun 30 23:39:02 np0000004054 sudo[8261]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-zedwishipzmwxpmpvdhjfviyahjjlpqc ; /usr/bin/python3' Jun 30 23:39:02 np0000004054 sudo[8261]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:39:02 np0000004054 sudo[8261]: pam_unix(sudo:session): session closed for user root Jun 30 23:39:02 np0000004054 sudo[8270]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-grdqgwweycqtifczswrdgjodrisftkop ; /usr/bin/python3' Jun 30 23:39:02 np0000004054 sudo[8270]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:39:02 np0000004054 sudo[8270]: pam_unix(sudo:session): session closed for user root Jun 30 23:39:03 np0000004054 sudo[8278]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-giitywssedmiutvzymutvhinigtghztl ; /usr/bin/python3' Jun 30 23:39:03 np0000004054 sudo[8278]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:39:04 np0000004054 sudo[8278]: pam_unix(sudo:session): session closed for user root Jun 30 23:39:04 np0000004054 sudo[8330]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-zazktnmjeuxfcgqjlfnvzfpkjkwpicrg ; /usr/bin/python3' Jun 30 23:39:04 np0000004054 sudo[8330]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:39:04 np0000004054 kernel: virtio_net virtio7 sp-api: renamed from enp9s0 Jun 30 23:39:04 np0000004054 kernel: virtio_net virtio8 sp0: renamed from enp10s0 Jun 30 23:39:05 np0000004054 kernel: virtio_net virtio9 sp1: renamed from enp11s0 Jun 30 23:39:05 np0000004054 kernel: 8021q: adding VLAN 0 to HW filter on device sp1 Jun 30 23:39:05 np0000004054 kernel: 8021q: adding VLAN 0 to HW filter on device sp0 Jun 30 23:39:05 np0000004054 kernel: 8021q: adding VLAN 0 to HW filter on device sp-api Jun 30 23:39:05 np0000004054 sudo[8330]: pam_unix(sudo:session): session closed for user root Jun 30 23:39:56 np0000004054 sudo[8563]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-lpzpabjxrhbzkeidvxwqammxhmxqwlhq ; cat /etc/os-release' Jun 30 23:39:56 np0000004054 sudo[8563]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:39:56 np0000004054 sudo[8563]: pam_unix(sudo:session): session closed for user root Jun 30 23:39:56 np0000004054 sudo[8567]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-jmakjhgwoyawjdcglxxzwvufddbhrqof ; apt-get update && env DEBIAN_FRONTEND=noninteractive apt-get install -y python3' Jun 30 23:39:56 np0000004054 sudo[8567]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:39:59 np0000004054 sudo[8567]: pam_unix(sudo:session): session closed for user root Jun 30 23:40:01 np0000004054 sudo[8955]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-aavogdtcgwqrrmakpiaeckrfghvoxtci ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782862801.1139805-9968-31702699702091/AnsiballZ_apt.py' Jun 30 23:40:01 np0000004054 sudo[8955]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:40:02 np0000004054 sudo[8955]: pam_unix(sudo:session): session closed for user root Jun 30 23:40:03 np0000004054 sudo[9238]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-fjwhwesjjwyrjfzlxjodwrlfbjotvary ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782862802.9379072-9976-185198354866591/AnsiballZ_apt.py' Jun 30 23:40:03 np0000004054 sudo[9238]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:40:11 np0000004054 sudo[9238]: pam_unix(sudo:session): session closed for user root Jun 30 23:40:11 np0000004054 sudo[14819]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-pjqeyluvkyzsdivyimnvhdaxqepsvudq ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782862811.7427542-9986-200854744349214/AnsiballZ_get_url.py' Jun 30 23:40:11 np0000004054 sudo[14819]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:40:12 np0000004054 sudo[14819]: pam_unix(sudo:session): session closed for user root Jun 30 23:40:12 np0000004054 sudo[14837]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-asswigduurybkilhqbpmmgvsxpthzqtl ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782862812.3521793-9994-146913478880641/AnsiballZ_stat.py' Jun 30 23:40:12 np0000004054 sudo[14837]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:40:12 np0000004054 sudo[14837]: pam_unix(sudo:session): session closed for user root Jun 30 23:40:12 np0000004054 sudo[14848]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-oetchqzigvmwrfmvhcstfqxfmdejvydc ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782862812.3521793-9994-146913478880641/AnsiballZ_copy.py' Jun 30 23:40:12 np0000004054 sudo[14848]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:40:13 np0000004054 sudo[14848]: pam_unix(sudo:session): session closed for user root Jun 30 23:40:13 np0000004054 sudo[14866]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-chqyrhndvwdokvpndlcvopymllfogbxx ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782862813.2729747-10010-179735728961068/AnsiballZ_apt.py' Jun 30 23:40:13 np0000004054 sudo[14866]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:40:17 np0000004054 sudo[14866]: pam_unix(sudo:session): session closed for user root Jun 30 23:40:17 np0000004054 sudo[15190]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-ymfzimoekitdhygeywgololkrvilozoz ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782862817.6797512-10020-246238585147749/AnsiballZ_apt.py' Jun 30 23:40:17 np0000004054 sudo[15190]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:40:27 np0000004054 sudo[15190]: pam_unix(sudo:session): session closed for user root Jun 30 23:40:27 np0000004054 sudo[15350]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-uttpfjxaxoytmusqxsuyugeverngaepd ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782862827.73476-10049-231550221330537/AnsiballZ_apt.py' Jun 30 23:40:27 np0000004054 sudo[15350]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:40:30 np0000004054 sudo[15350]: pam_unix(sudo:session): session closed for user root Jun 30 23:40:30 np0000004054 sudo[15667]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-rcwrgmrpiqfwdpoermnlgsihrdikxezd ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782862830.1138594-10059-97196419589128/AnsiballZ_apt.py' Jun 30 23:40:30 np0000004054 sudo[15667]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:40:31 np0000004054 sudo[15667]: pam_unix(sudo:session): session closed for user root Jun 30 23:40:31 np0000004054 sudo[15691]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-oaryhpkbmutusxlkssnqmbrjsrmkbtur ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782862831.1770058-10069-70995304996041/AnsiballZ_apt.py' Jun 30 23:40:31 np0000004054 sudo[15691]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:40:44 np0000004054 kernel: Key type psk registered Jun 30 23:40:46 np0000004054 kernel: audit: type=1400 audit(1782862846.761:125): apparmor="STATUS" operation="profile_load" profile="unconfined" name="/usr/sbin/chronyd" pid=17289 comm="apparmor_parser" Jun 30 23:40:51 np0000004054 sudo[15691]: pam_unix(sudo:session): session closed for user root Jun 30 23:40:51 np0000004054 sudo[17551]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-daeigeqmbtzezqawvyxrtwinxeofvqtq ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782862851.33843-10078-175337258570078/AnsiballZ_stat.py' Jun 30 23:40:51 np0000004054 sudo[17551]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:40:51 np0000004054 sudo[17551]: pam_unix(sudo:session): session closed for user root Jun 30 23:40:51 np0000004054 sudo[17562]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-kqjporfctgcnhmatizbbwwczkhkxkxdy ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782862851.33843-10078-175337258570078/AnsiballZ_copy.py' Jun 30 23:40:51 np0000004054 sudo[17562]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:40:51 np0000004054 sudo[17562]: pam_unix(sudo:session): session closed for user root Jun 30 23:40:52 np0000004054 sudo[17580]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-kszhduutfoacxhlaganwgdkriltrxxgj ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782862851.988134-10093-179910611499479/AnsiballZ_mount.py' Jun 30 23:40:52 np0000004054 sudo[17580]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:40:52 np0000004054 sudo[17580]: pam_unix(sudo:session): session closed for user root Jun 30 23:40:52 np0000004054 sudo[17599]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-ezsbymiobbfmcorxghcfjoddfmsjpfnr ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782862852.4839122-10101-65161092643754/AnsiballZ_command.py' Jun 30 23:40:52 np0000004054 sudo[17599]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:40:53 np0000004054 sudo[17599]: pam_unix(sudo:session): session closed for user root Jun 30 23:40:53 np0000004054 sudo[17618]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-jzsdzhossreqnqccgddgcuuzqwqajksq ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782862853.0800498-10109-52957067812545/AnsiballZ_lineinfile.py' Jun 30 23:40:53 np0000004054 sudo[17618]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:40:53 np0000004054 sudo[17618]: pam_unix(sudo:session): session closed for user root Jun 30 23:40:54 np0000004054 sudo[17683]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-ajwhyncxfqojehtlhkvwqipqguhcbztx ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782862854.6351736-10141-221558109764652/AnsiballZ_lineinfile.py' Jun 30 23:40:54 np0000004054 sudo[17683]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:40:54 np0000004054 sudo[17683]: pam_unix(sudo:session): session closed for user root Jun 30 23:40:58 np0000004054 sudo[18170]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-rbjbouctdtosjndnkqczjeelnkeqheup ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782862858.3694823-10157-144045350641297/AnsiballZ_systemd.py' Jun 30 23:40:58 np0000004054 sudo[18170]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:40:59 np0000004054 sudo[18170]: pam_unix(sudo:session): session closed for user root Jun 30 23:41:01 np0000004054 sudo[18207]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-udkhsmnqfrynbbpurpacpbrcgdyxwzus ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782862861.2941039-10178-261123451855349/AnsiballZ_lineinfile.py' Jun 30 23:41:01 np0000004054 sudo[18207]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:41:01 np0000004054 sudo[18207]: pam_unix(sudo:session): session closed for user root Jun 30 23:41:01 np0000004054 sudo[18225]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-aagfhnphmogciyotfoqteoqjafusynzc ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782862861.6567278-10178-130380667120033/AnsiballZ_lineinfile.py' Jun 30 23:41:01 np0000004054 sudo[18225]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:41:01 np0000004054 sudo[18225]: pam_unix(sudo:session): session closed for user root Jun 30 23:41:02 np0000004054 sudo[18243]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-xeiafnbcajsnvlurehlsgufgnfickjar ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782862862.0289524-10193-24903040495115/AnsiballZ_systemd.py' Jun 30 23:41:02 np0000004054 sudo[18243]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:41:02 np0000004054 sudo[18243]: pam_unix(sudo:session): session closed for user root Jun 30 23:41:02 np0000004054 sudo[18308]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-tgqybaabwbweltzlvvpjpinopwqeozuv ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782862862.8859282-10193-161474129886737/AnsiballZ_systemd.py' Jun 30 23:41:02 np0000004054 sudo[18308]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:41:03 np0000004054 sudo[18308]: pam_unix(sudo:session): session closed for user root Jun 30 23:41:03 np0000004054 sudo[18330]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-uyjypbgeboaefutbqpgznzmqnjrdvqmm ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782862863.4659162-10208-83058220618187/AnsiballZ_lineinfile.py' Jun 30 23:41:03 np0000004054 sudo[18330]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:41:03 np0000004054 sudo[18330]: pam_unix(sudo:session): session closed for user root Jun 30 23:41:03 np0000004054 sudo[18348]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-hhlgqpnuvumjcuzrpafqgcigwgxffemh ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782862863.882307-10216-831246417065/AnsiballZ_systemd.py' Jun 30 23:41:03 np0000004054 sudo[18348]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:41:04 np0000004054 sudo[18348]: pam_unix(sudo:session): session closed for user root Jun 30 23:41:06 np0000004054 sudo[18515]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-uorwcxeunncwgzslfkhxgxcepstglxmx ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782862866.0248594-10250-205476780287569/AnsiballZ_stat.py' Jun 30 23:41:06 np0000004054 sudo[18515]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:41:06 np0000004054 sudo[18515]: pam_unix(sudo:session): session closed for user root Jun 30 23:41:06 np0000004054 sudo[18526]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-qznsyfdrxoerlbfhjbazmqpezcihaiwa ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782862866.0248594-10250-205476780287569/AnsiballZ_copy.py' Jun 30 23:41:06 np0000004054 sudo[18526]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:41:06 np0000004054 sudo[18526]: pam_unix(sudo:session): session closed for user root Jun 30 23:41:07 np0000004054 sudo[18559]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-ejxxuvcmnmvcpclkeikdrystlucxnctb ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782862867.1980453-10273-130119710928873/AnsiballZ_file.py' Jun 30 23:41:07 np0000004054 sudo[18559]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:41:07 np0000004054 sudo[18559]: pam_unix(sudo:session): session closed for user root Jun 30 23:41:07 np0000004054 sudo[18577]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-lzbxqrkwjsvcbggrlvjopcvjucyitbwd ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782862867.5745149-10273-99629925974530/AnsiballZ_file.py' Jun 30 23:41:07 np0000004054 sudo[18577]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:41:07 np0000004054 sudo[18577]: pam_unix(sudo:session): session closed for user root Jun 30 23:41:07 np0000004054 sudo[18595]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-miirwokxpskhwqfkqmfijbgvbxgrmgfz ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782862867.920324-10273-143481769875232/AnsiballZ_file.py' Jun 30 23:41:07 np0000004054 sudo[18595]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:41:08 np0000004054 sudo[18595]: pam_unix(sudo:session): session closed for user root Jun 30 23:41:08 np0000004054 sudo[18613]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-yybdczjlsbnpgndlopfbzkwuhrqitoho ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782862868.2663147-10273-2971380905782/AnsiballZ_file.py' Jun 30 23:41:08 np0000004054 sudo[18613]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:41:08 np0000004054 sudo[18613]: pam_unix(sudo:session): session closed for user root Jun 30 23:41:08 np0000004054 sudo[18631]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-rizfgigztpxdyyuotfurmppgeerwnpht ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782862868.602828-10273-241576232691875/AnsiballZ_file.py' Jun 30 23:41:08 np0000004054 sudo[18631]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:41:08 np0000004054 sudo[18631]: pam_unix(sudo:session): session closed for user root Jun 30 23:41:09 np0000004054 sudo[18649]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-eccmxfbhuzmhylacafsufibsufrpljjp ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782862869.2451575-10317-223732968247234/AnsiballZ_apt.py' Jun 30 23:41:09 np0000004054 sudo[18649]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:41:10 np0000004054 sudo[18649]: pam_unix(sudo:session): session closed for user root Jun 30 23:41:10 np0000004054 sudo[18673]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-uoydaxknvrbfhegndnaioielizeeinpx ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782862870.2791488-10325-152548816874542/AnsiballZ_apt.py' Jun 30 23:41:10 np0000004054 sudo[18673]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:41:11 np0000004054 sudo[18673]: pam_unix(sudo:session): session closed for user root Jun 30 23:41:12 np0000004054 sudo[18727]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-isulbhqnomeazmbuoxjpizjxfbcnkswv ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782862872.4976892-10361-19642034693936/AnsiballZ_stat.py' Jun 30 23:41:12 np0000004054 sudo[18727]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:41:12 np0000004054 sudo[18727]: pam_unix(sudo:session): session closed for user root Jun 30 23:41:12 np0000004054 sudo[18738]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-wbqfobebyannnlriususqhruzukueaaz ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782862872.4976892-10361-19642034693936/AnsiballZ_copy.py' Jun 30 23:41:12 np0000004054 sudo[18738]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:41:13 np0000004054 sudo[18738]: pam_unix(sudo:session): session closed for user root Jun 30 23:41:13 np0000004054 sudo[18756]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-uglmdizajyfuaftkdgamjjytvdzvdfpe ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782862873.1870127-10376-98326724908980/AnsiballZ_command.py' Jun 30 23:41:13 np0000004054 sudo[18756]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:41:13 np0000004054 sudo[18756]: pam_unix(sudo:session): session closed for user root Jun 30 23:41:14 np0000004054 sudo[18776]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-gvtcxisbvahfkxlrnoanltmtjzjibmxr ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782862874.0557415-10385-21480322126966/AnsiballZ_file.py' Jun 30 23:41:14 np0000004054 sudo[18776]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:41:14 np0000004054 sudo[18776]: pam_unix(sudo:session): session closed for user root Jun 30 23:41:15 np0000004054 sudo[18795]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-cjftjgzvwgwruaejmyvoxwrntktidyti ; ANSIBLE_ASYNC_DIR=\'~/.ansible_async\' /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782862874.83874-10415-84928986014657/async_wrapper.py j287387379142 1000 false /home/ubuntu/.ansible/tmp/ansible-tmp-1782862874.83874-10415-84928986014657/AnsiballZ_command.py /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782862874.83874-10415-84928986014657/AnsiballZ_command.py' Jun 30 23:41:15 np0000004054 sudo[18795]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:41:15 np0000004054 sudo[18795]: pam_unix(sudo:session): session closed for user root Jun 30 23:41:15 np0000004054 sudo[18975]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-wjbeaolwxctovvvxxmingpbxzqidaccv ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782862875.813802-10441-176422033290099/AnsiballZ_async_status.py' Jun 30 23:41:15 np0000004054 sudo[18975]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:41:16 np0000004054 sudo[18975]: pam_unix(sudo:session): session closed for user root Jun 30 23:41:21 np0000004054 sudo[19509]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-dkslgzlucajqxwmnbxjtzpaqdlkuctlo ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782862881.2564945-10441-159260948890931/AnsiballZ_async_status.py' Jun 30 23:41:21 np0000004054 sudo[19509]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:41:21 np0000004054 sudo[19509]: pam_unix(sudo:session): session closed for user root Jun 30 23:41:26 np0000004054 sudo[19983]: ubuntu : TTY=pts/1 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-lnaasrgewsgppgghkrnobxvfcqvazqmn ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782862886.6194525-10441-205063071166736/AnsiballZ_async_status.py' Jun 30 23:41:26 np0000004054 sudo[19983]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:41:26 np0000004054 sudo[19983]: pam_unix(sudo:session): session closed for user root Jun 30 23:41:32 np0000004054 sudo[20098]: ubuntu : TTY=pts/1 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-saiohwjwydyxiecymgzivqnvtdlbcpee ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782862891.9725769-10441-173810756662404/AnsiballZ_async_status.py' Jun 30 23:41:32 np0000004054 sudo[20098]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:41:32 np0000004054 sudo[20098]: pam_unix(sudo:session): session closed for user root Jun 30 23:41:37 np0000004054 sudo[21074]: ubuntu : TTY=pts/1 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-aonopccivdruwqibqizxsyysngcdpnov ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782862897.2991362-10441-122047802577412/AnsiballZ_async_status.py' Jun 30 23:41:37 np0000004054 sudo[21074]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:41:37 np0000004054 sudo[21074]: pam_unix(sudo:session): session closed for user root Jun 30 23:41:42 np0000004054 sudo[24613]: ubuntu : TTY=pts/1 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-frjukwkgpzerxfudzfzfcqryegnnonzm ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782862902.6213691-10441-170038700303834/AnsiballZ_async_status.py' Jun 30 23:41:42 np0000004054 sudo[24613]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:41:42 np0000004054 sudo[24613]: pam_unix(sudo:session): session closed for user root Jun 30 23:41:44 np0000004054 kernel: audit: type=1400 audit(1782862904.844:126): apparmor="STATUS" operation="profile_replace" info="same as current profile, skipping" profile="unconfined" name="rsyslogd" pid=25444 comm="apparmor_parser" Jun 30 23:41:48 np0000004054 sudo[27221]: ubuntu : TTY=pts/1 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-obzkskmpscwwzovhitlixgnkamrjejxd ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782862907.9619317-10441-211540582507274/AnsiballZ_async_status.py' Jun 30 23:41:48 np0000004054 sudo[27221]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:41:48 np0000004054 sudo[27221]: pam_unix(sudo:session): session closed for user root Jun 30 23:41:53 np0000004054 sudo[32223]: ubuntu : TTY=pts/1 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-nturacorbrybldqeurdmvrwfkuxvlmob ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782862913.3569288-10441-141742985408945/AnsiballZ_async_status.py' Jun 30 23:41:53 np0000004054 sudo[32223]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:41:53 np0000004054 sudo[32223]: pam_unix(sudo:session): session closed for user root Jun 30 23:41:58 np0000004054 sudo[33242]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-ticwltkzfockkbsrtfbqvgnmnvtgrxwu ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782862918.6876113-10441-253798649421095/AnsiballZ_async_status.py' Jun 30 23:41:58 np0000004054 sudo[33242]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:41:58 np0000004054 sudo[33242]: pam_unix(sudo:session): session closed for user root Jun 30 23:42:04 np0000004054 sudo[33666]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-vufbvnjkynmyzihnaptwzrqwxhycuuej ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782862924.0252712-10441-216843877106405/AnsiballZ_async_status.py' Jun 30 23:42:04 np0000004054 sudo[33666]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:42:04 np0000004054 sudo[33666]: pam_unix(sudo:session): session closed for user root Jun 30 23:42:04 np0000004054 kernel: audit: type=1400 audit(1782862924.819:127): apparmor="STATUS" operation="profile_replace" info="same as current profile, skipping" profile="unconfined" name="rsyslogd" pid=33692 comm="apparmor_parser" Jun 30 23:42:09 np0000004054 sudo[33900]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-idurplaqowffqbcmrgslraxjtsuviksu ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782862929.3861685-10441-103378664626593/AnsiballZ_async_status.py' Jun 30 23:42:09 np0000004054 sudo[33900]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:42:09 np0000004054 sudo[33900]: pam_unix(sudo:session): session closed for user root Jun 30 23:42:10 np0000004054 kernel: audit: type=1400 audit(1782862930.555:128): apparmor="STATUS" operation="profile_replace" profile="unconfined" name="tcpdump" pid=33909 comm="apparmor_parser" Jun 30 23:42:14 np0000004054 sudo[37495]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-ktnygxmokqgectbrjqfoumcrcftzqcnl ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782862934.70561-10441-180894609438232/AnsiballZ_async_status.py' Jun 30 23:42:14 np0000004054 sudo[37495]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:42:14 np0000004054 sudo[37495]: pam_unix(sudo:session): session closed for user root Jun 30 23:42:20 np0000004054 sudo[41342]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-gbnwtryyfqhshkqivnvfltanlttytwam ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782862940.0399678-10441-73091533275771/AnsiballZ_async_status.py' Jun 30 23:42:20 np0000004054 sudo[41342]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:42:20 np0000004054 sudo[41342]: pam_unix(sudo:session): session closed for user root Jun 30 23:42:25 np0000004054 sudo[42016]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-czyywgxekaxyislorobgqzrbrxoddbhz ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782862945.3894897-10441-197831744137788/AnsiballZ_async_status.py' Jun 30 23:42:25 np0000004054 sudo[42016]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:42:25 np0000004054 sudo[42016]: pam_unix(sudo:session): session closed for user root Jun 30 23:42:25 np0000004054 sudo[42034]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-bkqzumhmvbhmgtvjlyfwfwoyndcewsyg ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782862945.7401092-10557-225815666850372/AnsiballZ_systemd.py' Jun 30 23:42:25 np0000004054 sudo[42034]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:42:26 np0000004054 kernel: audit: type=1400 audit(1782862946.252:129): apparmor="STATUS" operation="profile_replace" info="same as current profile, skipping" profile="unconfined" name="rsyslogd" pid=42046 comm="apparmor_parser" Jun 30 23:42:26 np0000004054 sudo[42034]: pam_unix(sudo:session): session closed for user root Jun 30 23:42:26 np0000004054 sudo[42066]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-jdggwmiubifjhyywdagwpoflphrpwbdz ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782862946.389845-10565-73772880971610/AnsiballZ_command.py' Jun 30 23:42:26 np0000004054 sudo[42066]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:42:26 np0000004054 sudo[42066]: pam_unix(sudo:session): session closed for user root Jun 30 23:42:26 np0000004054 sudo[42087]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-pcmlivqleisnljkxabayaqyebauvnbrv ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782862946.8056037-10575-26267188543882/AnsiballZ_command.py' Jun 30 23:42:26 np0000004054 sudo[42087]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:42:27 np0000004054 sudo[42087]: pam_unix(sudo:session): session closed for user root Jun 30 23:42:27 np0000004054 sudo[42106]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-zmhgjxcyautceobbnlolorzdrsqlrqgb ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782862947.257757-10583-100735724172976/AnsiballZ_lineinfile.py' Jun 30 23:42:27 np0000004054 sudo[42106]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:42:27 np0000004054 sudo[42106]: pam_unix(sudo:session): session closed for user root Jun 30 23:42:27 np0000004054 sudo[42124]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-dzrqgtxtginthvlbyffmudtrgunxuwny ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782862947.7102017-10594-130381614915311/AnsiballZ_command.py' Jun 30 23:42:27 np0000004054 sudo[42124]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:42:28 np0000004054 sudo[42124]: pam_unix(sudo:session): session closed for user root Jun 30 23:42:28 np0000004054 sudo[42146]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-tkcltnbjqdvlgcwduopzvfzxskdngvfd ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782862948.1478226-10602-95964853022842/AnsiballZ_systemd.py' Jun 30 23:42:28 np0000004054 sudo[42146]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:42:28 np0000004054 sudo[42146]: pam_unix(sudo:session): session closed for user root Jun 30 23:42:28 np0000004054 sudo[42166]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-fmompazmipigokkchqtadkliftnxiepr ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782862948.7188258-10611-55521201669657/AnsiballZ_stat.py' Jun 30 23:42:28 np0000004054 sudo[42166]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:42:29 np0000004054 sudo[42166]: pam_unix(sudo:session): session closed for user root Jun 30 23:42:29 np0000004054 sudo[42177]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-oipgfhjzhefsimgcjkuczugkcogecaak ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782862948.7188258-10611-55521201669657/AnsiballZ_copy.py' Jun 30 23:42:29 np0000004054 sudo[42177]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:42:29 np0000004054 sudo[42177]: pam_unix(sudo:session): session closed for user root Jun 30 23:42:29 np0000004054 sudo[42195]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-sujmhouiqmnbcmrflzphvaxaratnsfpn ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782862949.376501-10627-80150578093788/AnsiballZ_file.py' Jun 30 23:42:29 np0000004054 sudo[42195]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:42:29 np0000004054 sudo[42195]: pam_unix(sudo:session): session closed for user root Jun 30 23:42:29 np0000004054 sudo[42213]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-piffhcymlmpbxhjoxwhnvaiykygvofgc ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782862949.753266-10635-106546187166997/AnsiballZ_get_url.py' Jun 30 23:42:29 np0000004054 sudo[42213]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:42:30 np0000004054 sudo[42213]: pam_unix(sudo:session): session closed for user root Jun 30 23:42:30 np0000004054 sudo[42231]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-wtdsqxajgpgtszksvehneffqoorulkkf ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782862950.2482054-10643-148767715441029/AnsiballZ_file.py' Jun 30 23:42:30 np0000004054 sudo[42231]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:42:30 np0000004054 sudo[42231]: pam_unix(sudo:session): session closed for user root Jun 30 23:42:30 np0000004054 sudo[42249]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-wwjyacylbtfmgupjurgwmriagtrhdcit ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782862950.7341442-10655-275384506192895/AnsiballZ_stat.py' Jun 30 23:42:30 np0000004054 sudo[42249]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:42:31 np0000004054 sudo[42249]: pam_unix(sudo:session): session closed for user root Jun 30 23:42:31 np0000004054 sudo[42267]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-wsdxkqzfgrntpyvtkyjwrvxjcxdqmvpi ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782862951.0803-10663-5122866090482/AnsiballZ_command.py' Jun 30 23:42:31 np0000004054 sudo[42267]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:42:32 np0000004054 sudo[42267]: pam_unix(sudo:session): session closed for user root Jun 30 23:42:33 np0000004054 sudo[42683]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-pttzkdjmoyfiwnbvqbospnehboiddvnp ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782862953.118246-10675-84833604531083/AnsiballZ_command.py' Jun 30 23:42:33 np0000004054 sudo[42683]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:42:44 np0000004054 sudo[42683]: pam_unix(sudo:session): session closed for user root Jun 30 23:42:44 np0000004054 sudo[50603]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-jqfidawecgyhoyvodxgjzzfxorjvskvo ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782862964.7857058-10684-192601077321333/AnsiballZ_setup.py' Jun 30 23:42:44 np0000004054 sudo[50603]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:42:45 np0000004054 sudo[50603]: pam_unix(sudo:session): session closed for user root Jun 30 23:42:45 np0000004054 sudo[50641]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-hsbpinbbsivgudgeuthwaumymisytwvh ; cat /proc/sys/kernel/random/boot_id' Jun 30 23:42:45 np0000004054 sudo[50641]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:42:45 np0000004054 sudo[50641]: pam_unix(sudo:session): session closed for user root Jun 30 23:42:45 np0000004054 sudo[50649]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-cjudidzzumjwspvfawtbdmpsxchlvtbr ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782862964.7857058-10684-192601077321333/AnsiballZ_find.py' Jun 30 23:42:45 np0000004054 sudo[50649]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:42:45 np0000004054 sudo[50649]: pam_unix(sudo:session): session closed for user root Jun 30 23:42:45 np0000004054 sudo[50654]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-rkyfsilyqoghvxlbtnzwdfnrlynrluhh ; /sbin/shutdown -r 0 "Reboot initiated by Ansible"' Jun 30 23:42:45 np0000004054 sudo[50654]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:42:45 np0000004054 sudo[50654]: pam_unix(sudo:session): session closed for user root Jun 30 23:42:46 np0000004054 kernel: EXT4-fs (sda16): unmounting filesystem 7dc15ce9-d090-44d7-bb05-2a36d545a8e3. -- Boot a1ae95eb861042cd9e76fb5bf52bd6ad -- Jun 30 23:42:55 np0000004054 kernel: Linux version 6.8.0-124-generic (buildd@lcy02-amd64-019) (x86_64-linux-gnu-gcc-13 (Ubuntu 13.3.0-6ubuntu2~24.04.1) 13.3.0, GNU ld (GNU Binutils for Ubuntu) 2.42) #124-Ubuntu SMP PREEMPT_DYNAMIC Tue May 26 13:00:45 UTC 2026 (Ubuntu 6.8.0-124.124-generic 6.8.12) Jun 30 23:42:55 np0000004054 kernel: Command line: BOOT_IMAGE=/vmlinuz-6.8.0-124-generic root=UUID=8515de1c-ba7e-467b-adde-6d9f8a8dbc1f ro amd_pstate=guided i915.modeset=0 nomodeset usbcore.autosuspend=-1 vga=normal nofb video=vesafb:off swapaccount=1 systemd.legacy_systemd_cgroup_controller=1 systemd.unified_cgroup_hierarchy=0 libata.fua=1 console=tty1 console=ttyS0 crashkernel=1024M Jun 30 23:42:55 np0000004054 kernel: KERNEL supported cpus: Jun 30 23:42:55 np0000004054 kernel: Intel GenuineIntel Jun 30 23:42:55 np0000004054 kernel: AMD AuthenticAMD Jun 30 23:42:55 np0000004054 kernel: Hygon HygonGenuine Jun 30 23:42:55 np0000004054 kernel: Centaur CentaurHauls Jun 30 23:42:55 np0000004054 kernel: zhaoxin Shanghai Jun 30 23:42:55 np0000004054 kernel: BIOS-provided physical RAM map: Jun 30 23:42:55 np0000004054 kernel: BIOS-e820: [mem 0x0000000000000000-0x000000000009fbff] usable Jun 30 23:42:55 np0000004054 kernel: BIOS-e820: [mem 0x000000000009fc00-0x000000000009ffff] reserved Jun 30 23:42:55 np0000004054 kernel: BIOS-e820: [mem 0x00000000000f0000-0x00000000000fffff] reserved Jun 30 23:42:55 np0000004054 kernel: BIOS-e820: [mem 0x0000000000100000-0x000000007ffdafff] usable Jun 30 23:42:55 np0000004054 kernel: BIOS-e820: [mem 0x000000007ffdb000-0x000000007fffffff] reserved Jun 30 23:42:55 np0000004054 kernel: BIOS-e820: [mem 0x00000000b0000000-0x00000000bfffffff] reserved Jun 30 23:42:55 np0000004054 kernel: BIOS-e820: [mem 0x00000000fed1c000-0x00000000fed1ffff] reserved Jun 30 23:42:55 np0000004054 kernel: BIOS-e820: [mem 0x00000000feffc000-0x00000000feffffff] reserved Jun 30 23:42:55 np0000004054 kernel: BIOS-e820: [mem 0x00000000fffc0000-0x00000000ffffffff] reserved Jun 30 23:42:55 np0000004054 kernel: BIOS-e820: [mem 0x0000000100000000-0x000000067fffffff] usable Jun 30 23:42:55 np0000004054 kernel: BIOS-e820: [mem 0x000000fd00000000-0x000000ffffffffff] reserved Jun 30 23:42:55 np0000004054 kernel: NX (Execute Disable) protection: active Jun 30 23:42:55 np0000004054 kernel: APIC: Static calls initialized Jun 30 23:42:55 np0000004054 kernel: SMBIOS 3.0.0 present. Jun 30 23:42:55 np0000004054 kernel: DMI: OpenStack Foundation OpenStack Nova, BIOS 1.16.3-debian-1.16.3-2 04/01/2014 Jun 30 23:42:55 np0000004054 kernel: Hypervisor detected: KVM Jun 30 23:42:55 np0000004054 kernel: kvm-clock: Using msrs 4b564d01 and 4b564d00 Jun 30 23:42:55 np0000004054 kernel: kvm-clock: using sched offset of 665747792283 cycles Jun 30 23:42:55 np0000004054 kernel: clocksource: kvm-clock: mask: 0xffffffffffffffff max_cycles: 0x1cd42e4dffb, max_idle_ns: 881590591483 ns Jun 30 23:42:55 np0000004054 kernel: tsc: Detected 2395.498 MHz processor Jun 30 23:42:55 np0000004054 kernel: e820: update [mem 0x00000000-0x00000fff] usable ==> reserved Jun 30 23:42:55 np0000004054 kernel: e820: remove [mem 0x000a0000-0x000fffff] usable Jun 30 23:42:55 np0000004054 kernel: last_pfn = 0x680000 max_arch_pfn = 0x400000000 Jun 30 23:42:55 np0000004054 kernel: MTRR map: 4 entries (3 fixed + 1 variable; max 19), built from 8 variable MTRRs Jun 30 23:42:55 np0000004054 kernel: x86/PAT: Configuration [0-7]: WB WC UC- UC WB WP UC- WT Jun 30 23:42:55 np0000004054 kernel: last_pfn = 0x7ffdb max_arch_pfn = 0x400000000 Jun 30 23:42:55 np0000004054 kernel: found SMP MP-table at [mem 0x000f5380-0x000f538f] Jun 30 23:42:55 np0000004054 kernel: Using GB pages for direct mapping Jun 30 23:42:55 np0000004054 kernel: RAMDISK: [mem 0x344b7000-0x36252fff] Jun 30 23:42:55 np0000004054 kernel: ACPI: Early table checksum verification disabled Jun 30 23:42:55 np0000004054 kernel: ACPI: RSDP 0x00000000000F5340 000014 (v00 BOCHS ) Jun 30 23:42:55 np0000004054 kernel: ACPI: RSDT 0x000000007FFE3A81 000034 (v01 BOCHS BXPC 00000001 BXPC 00000001) Jun 30 23:42:55 np0000004054 kernel: ACPI: FACP 0x000000007FFE3859 0000F4 (v03 BOCHS BXPC 00000001 BXPC 00000001) Jun 30 23:42:55 np0000004054 kernel: ACPI: DSDT 0x000000007FFDFB00 003D59 (v01 BOCHS BXPC 00000001 BXPC 00000001) Jun 30 23:42:55 np0000004054 kernel: ACPI: FACS 0x000000007FFDFAC0 000040 Jun 30 23:42:55 np0000004054 kernel: ACPI: APIC 0x000000007FFE394D 0000D0 (v03 BOCHS BXPC 00000001 BXPC 00000001) Jun 30 23:42:55 np0000004054 kernel: ACPI: MCFG 0x000000007FFE3A1D 00003C (v01 BOCHS BXPC 00000001 BXPC 00000001) Jun 30 23:42:55 np0000004054 kernel: ACPI: WAET 0x000000007FFE3A59 000028 (v01 BOCHS BXPC 00000001 BXPC 00000001) Jun 30 23:42:55 np0000004054 kernel: ACPI: Reserving FACP table memory at [mem 0x7ffe3859-0x7ffe394c] Jun 30 23:42:55 np0000004054 kernel: ACPI: Reserving DSDT table memory at [mem 0x7ffdfb00-0x7ffe3858] Jun 30 23:42:55 np0000004054 kernel: ACPI: Reserving FACS table memory at [mem 0x7ffdfac0-0x7ffdfaff] Jun 30 23:42:55 np0000004054 kernel: ACPI: Reserving APIC table memory at [mem 0x7ffe394d-0x7ffe3a1c] Jun 30 23:42:55 np0000004054 kernel: ACPI: Reserving MCFG table memory at [mem 0x7ffe3a1d-0x7ffe3a58] Jun 30 23:42:55 np0000004054 kernel: ACPI: Reserving WAET table memory at [mem 0x7ffe3a59-0x7ffe3a80] Jun 30 23:42:55 np0000004054 kernel: No NUMA configuration found Jun 30 23:42:55 np0000004054 kernel: Faking a node at [mem 0x0000000000000000-0x000000067fffffff] Jun 30 23:42:55 np0000004054 kernel: NODE_DATA(0) allocated [mem 0x67ffd5000-0x67fffffff] Jun 30 23:42:55 np0000004054 kernel: crashkernel reserved: 0x000000003f000000 - 0x000000007f000000 (1024 MB) Jun 30 23:42:55 np0000004054 kernel: Zone ranges: Jun 30 23:42:55 np0000004054 kernel: DMA [mem 0x0000000000001000-0x0000000000ffffff] Jun 30 23:42:55 np0000004054 kernel: DMA32 [mem 0x0000000001000000-0x00000000ffffffff] Jun 30 23:42:55 np0000004054 kernel: Normal [mem 0x0000000100000000-0x000000067fffffff] Jun 30 23:42:55 np0000004054 kernel: Device empty Jun 30 23:42:55 np0000004054 kernel: Movable zone start for each node Jun 30 23:42:55 np0000004054 kernel: Early memory node ranges Jun 30 23:42:55 np0000004054 kernel: node 0: [mem 0x0000000000001000-0x000000000009efff] Jun 30 23:42:55 np0000004054 kernel: node 0: [mem 0x0000000000100000-0x000000007ffdafff] Jun 30 23:42:55 np0000004054 kernel: node 0: [mem 0x0000000100000000-0x000000067fffffff] Jun 30 23:42:55 np0000004054 kernel: Initmem setup node 0 [mem 0x0000000000001000-0x000000067fffffff] Jun 30 23:42:55 np0000004054 kernel: On node 0, zone DMA: 1 pages in unavailable ranges Jun 30 23:42:55 np0000004054 kernel: On node 0, zone DMA: 97 pages in unavailable ranges Jun 30 23:42:55 np0000004054 kernel: On node 0, zone Normal: 37 pages in unavailable ranges Jun 30 23:42:55 np0000004054 kernel: ACPI: PM-Timer IO Port: 0x608 Jun 30 23:42:55 np0000004054 kernel: ACPI: LAPIC_NMI (acpi_id[0xff] dfl dfl lint[0x1]) Jun 30 23:42:55 np0000004054 kernel: IOAPIC[0]: apic_id 0, version 17, address 0xfec00000, GSI 0-23 Jun 30 23:42:55 np0000004054 kernel: ACPI: INT_SRC_OVR (bus 0 bus_irq 0 global_irq 2 dfl dfl) Jun 30 23:42:55 np0000004054 kernel: ACPI: INT_SRC_OVR (bus 0 bus_irq 5 global_irq 5 high level) Jun 30 23:42:55 np0000004054 kernel: ACPI: INT_SRC_OVR (bus 0 bus_irq 9 global_irq 9 high level) Jun 30 23:42:55 np0000004054 kernel: ACPI: INT_SRC_OVR (bus 0 bus_irq 10 global_irq 10 high level) Jun 30 23:42:55 np0000004054 kernel: ACPI: INT_SRC_OVR (bus 0 bus_irq 11 global_irq 11 high level) Jun 30 23:42:55 np0000004054 kernel: ACPI: Using ACPI (MADT) for SMP configuration information Jun 30 23:42:55 np0000004054 kernel: TSC deadline timer available Jun 30 23:42:55 np0000004054 kernel: smpboot: Allowing 12 CPUs, 0 hotplug CPUs Jun 30 23:42:55 np0000004054 kernel: kvm-guest: APIC: eoi() replaced with kvm_guest_apic_eoi_write() Jun 30 23:42:55 np0000004054 kernel: PM: hibernation: Registered nosave memory: [mem 0x00000000-0x00000fff] Jun 30 23:42:55 np0000004054 kernel: PM: hibernation: Registered nosave memory: [mem 0x0009f000-0x000fffff] Jun 30 23:42:55 np0000004054 kernel: PM: hibernation: Registered nosave memory: [mem 0x7ffdb000-0xffffffff] Jun 30 23:42:55 np0000004054 kernel: [mem 0xc0000000-0xfed1bfff] available for PCI devices Jun 30 23:42:55 np0000004054 kernel: Booting paravirtualized kernel on KVM Jun 30 23:42:55 np0000004054 kernel: clocksource: refined-jiffies: mask: 0xffffffff max_cycles: 0xffffffff, max_idle_ns: 1910969940391419 ns Jun 30 23:42:55 np0000004054 kernel: setup_percpu: NR_CPUS:8192 nr_cpumask_bits:12 nr_cpu_ids:12 nr_node_ids:1 Jun 30 23:42:55 np0000004054 kernel: percpu: Embedded 86 pages/cpu s229376 r8192 d114688 u524288 Jun 30 23:42:55 np0000004054 kernel: pcpu-alloc: s229376 r8192 d114688 u524288 alloc=1*2097152 Jun 30 23:42:55 np0000004054 kernel: pcpu-alloc: [0] 00 01 02 03 [0] 04 05 06 07 Jun 30 23:42:55 np0000004054 kernel: pcpu-alloc: [0] 08 09 10 11 Jun 30 23:42:55 np0000004054 kernel: kvm-guest: PV spinlocks disabled, no host support Jun 30 23:42:55 np0000004054 kernel: Kernel command line: BOOT_IMAGE=/vmlinuz-6.8.0-124-generic root=UUID=8515de1c-ba7e-467b-adde-6d9f8a8dbc1f ro amd_pstate=guided i915.modeset=0 nomodeset usbcore.autosuspend=-1 vga=normal nofb video=vesafb:off swapaccount=1 systemd.legacy_systemd_cgroup_controller=1 systemd.unified_cgroup_hierarchy=0 libata.fua=1 console=tty1 console=ttyS0 crashkernel=1024M Jun 30 23:42:55 np0000004054 kernel: Booted with the nomodeset parameter. Only the system framebuffer will be available Jun 30 23:42:55 np0000004054 kernel: Unknown kernel command line parameters "nofb vga=normal", will be passed to user space. Jun 30 23:42:55 np0000004054 kernel: random: crng init done Jun 30 23:42:55 np0000004054 kernel: Dentry cache hash table entries: 4194304 (order: 13, 33554432 bytes, linear) Jun 30 23:42:55 np0000004054 kernel: Inode-cache hash table entries: 2097152 (order: 12, 16777216 bytes, linear) Jun 30 23:42:55 np0000004054 kernel: Fallback order for Node 0: 0 Jun 30 23:42:55 np0000004054 kernel: Built 1 zonelists, mobility grouping on. Total pages: 6192859 Jun 30 23:42:55 np0000004054 kernel: Policy zone: Normal Jun 30 23:42:55 np0000004054 kernel: mem auto-init: stack:all(zero), heap alloc:on, heap free:off Jun 30 23:42:55 np0000004054 kernel: software IO TLB: area num 16. Jun 30 23:42:55 np0000004054 kernel: Memory: 23519056K/25165284K available (22528K kernel code, 4438K rwdata, 14416K rodata, 4924K init, 4788K bss, 1645968K reserved, 0K cma-reserved) Jun 30 23:42:55 np0000004054 kernel: SLUB: HWalign=64, Order=0-3, MinObjects=0, CPUs=12, Nodes=1 Jun 30 23:42:55 np0000004054 kernel: ftrace: allocating 58286 entries in 228 pages Jun 30 23:42:55 np0000004054 kernel: ftrace: allocated 228 pages with 4 groups Jun 30 23:42:55 np0000004054 kernel: Dynamic Preempt: voluntary Jun 30 23:42:55 np0000004054 kernel: rcu: Preemptible hierarchical RCU implementation. Jun 30 23:42:55 np0000004054 kernel: rcu: RCU restricting CPUs from NR_CPUS=8192 to nr_cpu_ids=12. Jun 30 23:42:55 np0000004054 kernel: Trampoline variant of Tasks RCU enabled. Jun 30 23:42:55 np0000004054 kernel: Rude variant of Tasks RCU enabled. Jun 30 23:42:55 np0000004054 kernel: Tracing variant of Tasks RCU enabled. Jun 30 23:42:55 np0000004054 kernel: rcu: RCU calculated value of scheduler-enlistment delay is 100 jiffies. Jun 30 23:42:55 np0000004054 kernel: rcu: Adjusting geometry for rcu_fanout_leaf=16, nr_cpu_ids=12 Jun 30 23:42:55 np0000004054 kernel: RCU Tasks: Setting shift to 4 and lim to 1 rcu_task_cb_adjust=1 rcu_task_cpu_ids=12. Jun 30 23:42:55 np0000004054 kernel: RCU Tasks Rude: Setting shift to 4 and lim to 1 rcu_task_cb_adjust=1 rcu_task_cpu_ids=12. Jun 30 23:42:55 np0000004054 kernel: RCU Tasks Trace: Setting shift to 4 and lim to 1 rcu_task_cb_adjust=1 rcu_task_cpu_ids=12. Jun 30 23:42:55 np0000004054 kernel: NR_IRQS: 524544, nr_irqs: 520, preallocated irqs: 16 Jun 30 23:42:55 np0000004054 kernel: rcu: srcu_init: Setting srcu_struct sizes based on contention. Jun 30 23:42:55 np0000004054 kernel: Console: colour VGA+ 80x25 Jun 30 23:42:55 np0000004054 kernel: printk: legacy console [tty1] enabled Jun 30 23:42:55 np0000004054 kernel: printk: legacy console [ttyS0] enabled Jun 30 23:42:55 np0000004054 kernel: ACPI: Core revision 20230628 Jun 30 23:42:55 np0000004054 kernel: APIC: Switch to symmetric I/O mode setup Jun 30 23:42:55 np0000004054 kernel: x2apic enabled Jun 30 23:42:55 np0000004054 kernel: APIC: Switched APIC routing to: physical x2apic Jun 30 23:42:55 np0000004054 kernel: tsc: Marking TSC unstable due to TSCs unsynchronized Jun 30 23:42:55 np0000004054 kernel: Calibrating delay loop (skipped) preset value.. 4790.99 BogoMIPS (lpj=2395498) Jun 30 23:42:55 np0000004054 kernel: x86/cpu: User Mode Instruction Prevention (UMIP) activated Jun 30 23:42:55 np0000004054 kernel: Last level iTLB entries: 4KB 512, 2MB 255, 4MB 127 Jun 30 23:42:55 np0000004054 kernel: Last level dTLB entries: 4KB 512, 2MB 255, 4MB 127, 1GB 0 Jun 30 23:42:55 np0000004054 kernel: Spectre V1 : Mitigation: usercopy/swapgs barriers and __user pointer sanitization Jun 30 23:42:55 np0000004054 kernel: Spectre V2 : Mitigation: Retpolines Jun 30 23:42:55 np0000004054 kernel: Spectre V2 : Spectre v2 / SpectreRSB: Filling RSB on context switch and VMEXIT Jun 30 23:42:55 np0000004054 kernel: Spectre V2 : Enabling Restricted Speculation for firmware calls Jun 30 23:42:55 np0000004054 kernel: Spectre V2 : mitigation: Enabling conditional Indirect Branch Prediction Barrier Jun 30 23:42:55 np0000004054 kernel: Speculative Store Bypass: Mitigation: Speculative Store Bypass disabled via prctl Jun 30 23:42:55 np0000004054 kernel: Speculative Return Stack Overflow: IBPB-extending microcode not applied! Jun 30 23:42:55 np0000004054 kernel: Speculative Return Stack Overflow: WARNING: See https://kernel.org/doc/html/latest/admin-guide/hw-vuln/srso.html for mitigation options. Jun 30 23:42:55 np0000004054 kernel: active return thunk: srso_alias_return_thunk Jun 30 23:42:55 np0000004054 kernel: Speculative Return Stack Overflow: Vulnerable: Safe RET, no microcode Jun 30 23:42:55 np0000004054 kernel: Transient Scheduler Attacks: Forcing mitigation on in a VM Jun 30 23:42:55 np0000004054 kernel: Transient Scheduler Attacks: Vulnerable: Clear CPU buffers attempted, no microcode Jun 30 23:42:55 np0000004054 kernel: x86/fpu: Supporting XSAVE feature 0x001: 'x87 floating point registers' Jun 30 23:42:55 np0000004054 kernel: x86/fpu: Supporting XSAVE feature 0x002: 'SSE registers' Jun 30 23:42:55 np0000004054 kernel: x86/fpu: Supporting XSAVE feature 0x004: 'AVX registers' Jun 30 23:42:55 np0000004054 kernel: x86/fpu: Supporting XSAVE feature 0x200: 'Protection Keys User registers' Jun 30 23:42:55 np0000004054 kernel: x86/fpu: xstate_offset[2]: 576, xstate_sizes[2]: 256 Jun 30 23:42:55 np0000004054 kernel: x86/fpu: xstate_offset[9]: 832, xstate_sizes[9]: 8 Jun 30 23:42:55 np0000004054 kernel: x86/fpu: Enabled xstate features 0x207, context size is 840 bytes, using 'compacted' format. Jun 30 23:42:55 np0000004054 kernel: Freeing SMP alternatives memory: 48K Jun 30 23:42:55 np0000004054 kernel: pid_max: default: 32768 minimum: 301 Jun 30 23:42:55 np0000004054 kernel: LSM: initializing lsm=lockdown,capability,landlock,yama,apparmor,integrity Jun 30 23:42:55 np0000004054 kernel: landlock: Up and running. Jun 30 23:42:55 np0000004054 kernel: Yama: becoming mindful. Jun 30 23:42:55 np0000004054 kernel: AppArmor: AppArmor initialized Jun 30 23:42:55 np0000004054 kernel: Mount-cache hash table entries: 65536 (order: 7, 524288 bytes, linear) Jun 30 23:42:55 np0000004054 kernel: Mountpoint-cache hash table entries: 65536 (order: 7, 524288 bytes, linear) Jun 30 23:42:55 np0000004054 kernel: smpboot: CPU0: AMD EPYC-Milan Processor (family: 0x19, model: 0x1, stepping: 0x1) Jun 30 23:42:55 np0000004054 kernel: Performance Events: Fam17h+ core perfctr, AMD PMU driver. Jun 30 23:42:55 np0000004054 kernel: ... version: 0 Jun 30 23:42:55 np0000004054 kernel: ... bit width: 48 Jun 30 23:42:55 np0000004054 kernel: ... generic registers: 6 Jun 30 23:42:55 np0000004054 kernel: ... value mask: 0000ffffffffffff Jun 30 23:42:55 np0000004054 kernel: ... max period: 00007fffffffffff Jun 30 23:42:55 np0000004054 kernel: ... fixed-purpose events: 0 Jun 30 23:42:55 np0000004054 kernel: ... event mask: 000000000000003f Jun 30 23:42:55 np0000004054 kernel: signal: max sigframe size: 3376 Jun 30 23:42:55 np0000004054 kernel: rcu: Hierarchical SRCU implementation. Jun 30 23:42:55 np0000004054 kernel: rcu: Max phase no-delay instances is 400. Jun 30 23:42:55 np0000004054 kernel: smp: Bringing up secondary CPUs ... Jun 30 23:42:55 np0000004054 kernel: smpboot: x86: Booting SMP configuration: Jun 30 23:42:55 np0000004054 kernel: .... node #0, CPUs: #1 #2 #3 #4 #5 #6 #7 #8 #9 #10 #11 Jun 30 23:42:55 np0000004054 kernel: smp: Brought up 1 node, 12 CPUs Jun 30 23:42:55 np0000004054 kernel: smpboot: Max logical packages: 12 Jun 30 23:42:55 np0000004054 kernel: smpboot: Total of 12 processors activated (57491.95 BogoMIPS) Jun 30 23:42:55 np0000004054 kernel: devtmpfs: initialized Jun 30 23:42:55 np0000004054 kernel: x86/mm: Memory block size: 128MB Jun 30 23:42:55 np0000004054 kernel: clocksource: jiffies: mask: 0xffffffff max_cycles: 0xffffffff, max_idle_ns: 1911260446275000 ns Jun 30 23:42:55 np0000004054 kernel: futex hash table entries: 4096 (order: 6, 262144 bytes, linear) Jun 30 23:42:55 np0000004054 kernel: pinctrl core: initialized pinctrl subsystem Jun 30 23:42:55 np0000004054 kernel: PM: RTC time: 23:42:52, date: 2026-06-30 Jun 30 23:42:55 np0000004054 kernel: NET: Registered PF_NETLINK/PF_ROUTE protocol family Jun 30 23:42:55 np0000004054 kernel: DMA: preallocated 4096 KiB GFP_KERNEL pool for atomic allocations Jun 30 23:42:55 np0000004054 kernel: DMA: preallocated 4096 KiB GFP_KERNEL|GFP_DMA pool for atomic allocations Jun 30 23:42:55 np0000004054 kernel: DMA: preallocated 4096 KiB GFP_KERNEL|GFP_DMA32 pool for atomic allocations Jun 30 23:42:55 np0000004054 kernel: audit: initializing netlink subsys (disabled) Jun 30 23:42:55 np0000004054 kernel: audit: type=2000 audit(1782862971.817:1): state=initialized audit_enabled=0 res=1 Jun 30 23:42:55 np0000004054 kernel: thermal_sys: Registered thermal governor 'fair_share' Jun 30 23:42:55 np0000004054 kernel: thermal_sys: Registered thermal governor 'bang_bang' Jun 30 23:42:55 np0000004054 kernel: thermal_sys: Registered thermal governor 'step_wise' Jun 30 23:42:55 np0000004054 kernel: thermal_sys: Registered thermal governor 'user_space' Jun 30 23:42:55 np0000004054 kernel: thermal_sys: Registered thermal governor 'power_allocator' Jun 30 23:42:55 np0000004054 kernel: cpuidle: using governor ladder Jun 30 23:42:55 np0000004054 kernel: cpuidle: using governor menu Jun 30 23:42:55 np0000004054 kernel: acpiphp: ACPI Hot Plug PCI Controller Driver version: 0.5 Jun 30 23:42:55 np0000004054 kernel: PCI: ECAM [mem 0xb0000000-0xbfffffff] (base 0xb0000000) for domain 0000 [bus 00-ff] Jun 30 23:42:55 np0000004054 kernel: PCI: ECAM [mem 0xb0000000-0xbfffffff] reserved as E820 entry Jun 30 23:42:55 np0000004054 kernel: PCI: Using configuration type 1 for base access Jun 30 23:42:55 np0000004054 kernel: kprobes: kprobe jump-optimization is enabled. All kprobes are optimized if possible. Jun 30 23:42:55 np0000004054 kernel: HugeTLB: registered 1.00 GiB page size, pre-allocated 0 pages Jun 30 23:42:55 np0000004054 kernel: HugeTLB: 16380 KiB vmemmap can be freed for a 1.00 GiB page Jun 30 23:42:55 np0000004054 kernel: HugeTLB: registered 2.00 MiB page size, pre-allocated 0 pages Jun 30 23:42:55 np0000004054 kernel: HugeTLB: 28 KiB vmemmap can be freed for a 2.00 MiB page Jun 30 23:42:55 np0000004054 kernel: ACPI: Added _OSI(Module Device) Jun 30 23:42:55 np0000004054 kernel: ACPI: Added _OSI(Processor Device) Jun 30 23:42:55 np0000004054 kernel: ACPI: Added _OSI(Processor Aggregator Device) Jun 30 23:42:55 np0000004054 kernel: ACPI: 1 ACPI AML tables successfully acquired and loaded Jun 30 23:42:55 np0000004054 kernel: ACPI: _OSC evaluation for CPUs failed, trying _PDC Jun 30 23:42:55 np0000004054 kernel: ACPI: Interpreter enabled Jun 30 23:42:55 np0000004054 kernel: ACPI: PM: (supports S0 S3 S4 S5) Jun 30 23:42:55 np0000004054 kernel: ACPI: Using IOAPIC for interrupt routing Jun 30 23:42:55 np0000004054 kernel: PCI: Using host bridge windows from ACPI; if necessary, use "pci=nocrs" and report a bug Jun 30 23:42:55 np0000004054 kernel: PCI: Using E820 reservations for host bridge windows Jun 30 23:42:55 np0000004054 kernel: ACPI: Enabled 2 GPEs in block 00 to 3F Jun 30 23:42:55 np0000004054 kernel: ACPI: PCI Root Bridge [PCI0] (domain 0000 [bus 00-ff]) Jun 30 23:42:55 np0000004054 kernel: acpi PNP0A08:00: _OSC: OS supports [ExtendedConfig ASPM ClockPM Segments MSI EDR HPX-Type3] Jun 30 23:42:55 np0000004054 kernel: acpi PNP0A08:00: _OSC: platform does not support [PCIeHotplug LTR DPC] Jun 30 23:42:55 np0000004054 kernel: acpi PNP0A08:00: _OSC: OS now controls [SHPCHotplug PME AER PCIeCapability] Jun 30 23:42:55 np0000004054 kernel: PCI host bridge to bus 0000:00 Jun 30 23:42:55 np0000004054 kernel: pci_bus 0000:00: root bus resource [io 0x0000-0x0cf7 window] Jun 30 23:42:55 np0000004054 kernel: pci_bus 0000:00: root bus resource [io 0x0d00-0xffff window] Jun 30 23:42:55 np0000004054 kernel: pci_bus 0000:00: root bus resource [mem 0x000a0000-0x000bffff window] Jun 30 23:42:55 np0000004054 kernel: pci_bus 0000:00: root bus resource [mem 0x80000000-0xafffffff window] Jun 30 23:42:55 np0000004054 kernel: pci_bus 0000:00: root bus resource [mem 0xc0000000-0xfebfffff window] Jun 30 23:42:55 np0000004054 kernel: pci_bus 0000:00: root bus resource [mem 0xc000000000-0xc7ffffffff window] Jun 30 23:42:55 np0000004054 kernel: pci_bus 0000:00: root bus resource [bus 00-ff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:00.0: [8086:29c0] type 00 class 0x060000 conventional PCI endpoint Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:01.0: [1af4:1050] type 00 class 0x030000 conventional PCI endpoint Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:01.0: BAR 0 [mem 0xfb800000-0xfbffffff pref] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:01.0: BAR 2 [mem 0xc220000000-0xc220003fff 64bit pref] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:01.0: BAR 4 [mem 0xfea10000-0xfea10fff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:01.0: ROM [mem 0xfea00000-0xfea0ffff pref] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:01.0: Video device with shadowed ROM at [mem 0x000c0000-0x000dffff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.0: [1b36:000c] type 01 class 0x060400 PCIe Root Port Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.0: BAR 0 [mem 0xfea11000-0xfea11fff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.0: PCI bridge to [bus 01-02] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.0: bridge window [io 0xc000-0xcfff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.0: bridge window [mem 0xfc600000-0xfc9fffff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.0: bridge window [mem 0xc200000000-0xc21fffffff 64bit pref] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.1: [1b36:000c] type 01 class 0x060400 PCIe Root Port Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.1: BAR 0 [mem 0xfea12000-0xfea12fff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.1: PCI bridge to [bus 03] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.1: bridge window [mem 0xfe800000-0xfe9fffff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.1: bridge window [mem 0xc1e0000000-0xc1ffffffff 64bit pref] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.2: [1b36:000c] type 01 class 0x060400 PCIe Root Port Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.2: BAR 0 [mem 0xfea13000-0xfea13fff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.2: PCI bridge to [bus 04] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.2: bridge window [mem 0xfe600000-0xfe7fffff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.2: bridge window [mem 0xc1c0000000-0xc1dfffffff 64bit pref] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.3: [1b36:000c] type 01 class 0x060400 PCIe Root Port Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.3: BAR 0 [mem 0xfea14000-0xfea14fff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.3: PCI bridge to [bus 05] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.3: bridge window [mem 0xfe400000-0xfe5fffff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.3: bridge window [mem 0xc1a0000000-0xc1bfffffff 64bit pref] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.4: [1b36:000c] type 01 class 0x060400 PCIe Root Port Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.4: BAR 0 [mem 0xfea15000-0xfea15fff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.4: PCI bridge to [bus 06] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.4: bridge window [mem 0xfe200000-0xfe3fffff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.4: bridge window [mem 0xc180000000-0xc19fffffff 64bit pref] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.5: [1b36:000c] type 01 class 0x060400 PCIe Root Port Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.5: BAR 0 [mem 0xfea16000-0xfea16fff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.5: PCI bridge to [bus 07] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.5: bridge window [mem 0xfe000000-0xfe1fffff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.5: bridge window [mem 0xc160000000-0xc17fffffff 64bit pref] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.6: [1b36:000c] type 01 class 0x060400 PCIe Root Port Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.6: BAR 0 [mem 0xfea17000-0xfea17fff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.6: PCI bridge to [bus 08] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.6: bridge window [mem 0xfde00000-0xfdffffff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.6: bridge window [mem 0xc140000000-0xc15fffffff 64bit pref] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.7: [1b36:000c] type 01 class 0x060400 PCIe Root Port Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.7: BAR 0 [mem 0xfea18000-0xfea18fff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.7: PCI bridge to [bus 09] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.7: bridge window [mem 0xfdc00000-0xfddfffff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.7: bridge window [mem 0xc120000000-0xc13fffffff 64bit pref] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.0: [1b36:000c] type 01 class 0x060400 PCIe Root Port Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.0: BAR 0 [mem 0xfea19000-0xfea19fff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.0: PCI bridge to [bus 0a] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.0: bridge window [mem 0xfda00000-0xfdbfffff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.0: bridge window [mem 0xc100000000-0xc11fffffff 64bit pref] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.1: [1b36:000c] type 01 class 0x060400 PCIe Root Port Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.1: BAR 0 [mem 0xfea1a000-0xfea1afff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.1: PCI bridge to [bus 0b] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.1: bridge window [mem 0xfd800000-0xfd9fffff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.1: bridge window [mem 0xc0e0000000-0xc0ffffffff 64bit pref] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.2: [1b36:000c] type 01 class 0x060400 PCIe Root Port Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.2: BAR 0 [mem 0xfea1b000-0xfea1bfff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.2: PCI bridge to [bus 0c] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.2: bridge window [mem 0xfd600000-0xfd7fffff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.2: bridge window [mem 0xc0c0000000-0xc0dfffffff 64bit pref] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.3: [1b36:000c] type 01 class 0x060400 PCIe Root Port Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.3: BAR 0 [mem 0xfea1c000-0xfea1cfff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.3: PCI bridge to [bus 0d] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.3: bridge window [mem 0xfd400000-0xfd5fffff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.3: bridge window [mem 0xc0a0000000-0xc0bfffffff 64bit pref] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.4: [1b36:000c] type 01 class 0x060400 PCIe Root Port Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.4: BAR 0 [mem 0xfea1d000-0xfea1dfff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.4: PCI bridge to [bus 0e] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.4: bridge window [mem 0xfd200000-0xfd3fffff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.4: bridge window [mem 0xc080000000-0xc09fffffff 64bit pref] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.5: [1b36:000c] type 01 class 0x060400 PCIe Root Port Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.5: BAR 0 [mem 0xfea1e000-0xfea1efff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.5: PCI bridge to [bus 0f] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.5: bridge window [mem 0xfd000000-0xfd1fffff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.5: bridge window [mem 0xc060000000-0xc07fffffff 64bit pref] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.6: [1b36:000c] type 01 class 0x060400 PCIe Root Port Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.6: BAR 0 [mem 0xfea1f000-0xfea1ffff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.6: PCI bridge to [bus 10] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.6: bridge window [mem 0xfce00000-0xfcffffff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.6: bridge window [mem 0xc040000000-0xc05fffffff 64bit pref] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.7: [1b36:000c] type 01 class 0x060400 PCIe Root Port Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.7: BAR 0 [mem 0xfea20000-0xfea20fff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.7: PCI bridge to [bus 11] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.7: bridge window [mem 0xfcc00000-0xfcdfffff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.7: bridge window [mem 0xc020000000-0xc03fffffff 64bit pref] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:04.0: [1b36:000c] type 01 class 0x060400 PCIe Root Port Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:04.0: BAR 0 [mem 0xfea21000-0xfea21fff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:04.0: PCI bridge to [bus 12] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:04.0: bridge window [mem 0xfca00000-0xfcbfffff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:04.0: bridge window [mem 0xc000000000-0xc01fffffff 64bit pref] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:1f.0: [8086:2918] type 00 class 0x060100 conventional PCI endpoint Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:1f.0: quirk: [io 0x0600-0x067f] claimed by ICH6 ACPI/GPIO/TCO Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:1f.2: [8086:2922] type 00 class 0x010601 conventional PCI endpoint Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:1f.2: BAR 4 [io 0xd040-0xd05f] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:1f.2: BAR 5 [mem 0xfea22000-0xfea22fff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:1f.3: [8086:2930] type 00 class 0x0c0500 conventional PCI endpoint Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:1f.3: BAR 4 [io 0x0700-0x073f] Jun 30 23:42:55 np0000004054 kernel: pci 0000:01:00.0: [1b36:000e] type 01 class 0x060400 PCIe to PCI/PCI-X bridge Jun 30 23:42:55 np0000004054 kernel: pci 0000:01:00.0: BAR 0 [mem 0xfc800000-0xfc8000ff 64bit] Jun 30 23:42:55 np0000004054 kernel: pci 0000:01:00.0: PCI bridge to [bus 02] Jun 30 23:42:55 np0000004054 kernel: pci 0000:01:00.0: bridge window [io 0xc000-0xcfff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:01:00.0: bridge window [mem 0xfc600000-0xfc7fffff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:01:00.0: bridge window [mem 0xc200000000-0xc21fffffff 64bit pref] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.0: PCI bridge to [bus 01-02] Jun 30 23:42:55 np0000004054 kernel: pci_bus 0000:02: extended config space not accessible Jun 30 23:42:55 np0000004054 kernel: acpiphp: Slot [1] registered Jun 30 23:42:55 np0000004054 kernel: acpiphp: Slot [0] registered Jun 30 23:42:55 np0000004054 kernel: acpiphp: Slot [2] registered Jun 30 23:42:55 np0000004054 kernel: acpiphp: Slot [3] registered Jun 30 23:42:55 np0000004054 kernel: acpiphp: Slot [4] registered Jun 30 23:42:55 np0000004054 kernel: acpiphp: Slot [5] registered Jun 30 23:42:55 np0000004054 kernel: acpiphp: Slot [6] registered Jun 30 23:42:55 np0000004054 kernel: acpiphp: Slot [7] registered Jun 30 23:42:55 np0000004054 kernel: acpiphp: Slot [8] registered Jun 30 23:42:55 np0000004054 kernel: acpiphp: Slot [9] registered Jun 30 23:42:55 np0000004054 kernel: acpiphp: Slot [10] registered Jun 30 23:42:55 np0000004054 kernel: acpiphp: Slot [11] registered Jun 30 23:42:55 np0000004054 kernel: acpiphp: Slot [12] registered Jun 30 23:42:55 np0000004054 kernel: acpiphp: Slot [13] registered Jun 30 23:42:55 np0000004054 kernel: acpiphp: Slot [14] registered Jun 30 23:42:55 np0000004054 kernel: acpiphp: Slot [15] registered Jun 30 23:42:55 np0000004054 kernel: acpiphp: Slot [16] registered Jun 30 23:42:55 np0000004054 kernel: acpiphp: Slot [17] registered Jun 30 23:42:55 np0000004054 kernel: acpiphp: Slot [18] registered Jun 30 23:42:55 np0000004054 kernel: acpiphp: Slot [19] registered Jun 30 23:42:55 np0000004054 kernel: acpiphp: Slot [20] registered Jun 30 23:42:55 np0000004054 kernel: acpiphp: Slot [21] registered Jun 30 23:42:55 np0000004054 kernel: acpiphp: Slot [22] registered Jun 30 23:42:55 np0000004054 kernel: acpiphp: Slot [23] registered Jun 30 23:42:55 np0000004054 kernel: acpiphp: Slot [24] registered Jun 30 23:42:55 np0000004054 kernel: acpiphp: Slot [25] registered Jun 30 23:42:55 np0000004054 kernel: acpiphp: Slot [26] registered Jun 30 23:42:55 np0000004054 kernel: acpiphp: Slot [27] registered Jun 30 23:42:55 np0000004054 kernel: acpiphp: Slot [28] registered Jun 30 23:42:55 np0000004054 kernel: acpiphp: Slot [29] registered Jun 30 23:42:55 np0000004054 kernel: acpiphp: Slot [30] registered Jun 30 23:42:55 np0000004054 kernel: acpiphp: Slot [31] registered Jun 30 23:42:55 np0000004054 kernel: pci 0000:02:01.0: [8086:7020] type 00 class 0x0c0300 conventional PCI endpoint Jun 30 23:42:55 np0000004054 kernel: pci 0000:02:01.0: BAR 4 [io 0xc000-0xc01f] Jun 30 23:42:55 np0000004054 kernel: pci 0000:01:00.0: PCI bridge to [bus 02] Jun 30 23:42:55 np0000004054 kernel: acpiphp: Slot [0-2] registered Jun 30 23:42:55 np0000004054 kernel: pci 0000:03:00.0: [1af4:1041] type 00 class 0x020000 PCIe Endpoint Jun 30 23:42:55 np0000004054 kernel: pci 0000:03:00.0: BAR 1 [mem 0xfe880000-0xfe880fff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:03:00.0: BAR 4 [mem 0xc1e0000000-0xc1e0003fff 64bit pref] Jun 30 23:42:55 np0000004054 kernel: pci 0000:03:00.0: ROM [mem 0xfe800000-0xfe87ffff pref] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.1: PCI bridge to [bus 03] Jun 30 23:42:55 np0000004054 kernel: acpiphp: Slot [0-3] registered Jun 30 23:42:55 np0000004054 kernel: pci 0000:04:00.0: [1af4:1048] type 00 class 0x010000 PCIe Endpoint Jun 30 23:42:55 np0000004054 kernel: pci 0000:04:00.0: BAR 1 [mem 0xfe600000-0xfe600fff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:04:00.0: BAR 4 [mem 0xc1c0000000-0xc1c0003fff 64bit pref] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.2: PCI bridge to [bus 04] Jun 30 23:42:55 np0000004054 kernel: acpiphp: Slot [0-4] registered Jun 30 23:42:55 np0000004054 kernel: pci 0000:05:00.0: [1af4:1045] type 00 class 0x00ff00 PCIe Endpoint Jun 30 23:42:55 np0000004054 kernel: pci 0000:05:00.0: BAR 4 [mem 0xc1a0000000-0xc1a0003fff 64bit pref] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.3: PCI bridge to [bus 05] Jun 30 23:42:55 np0000004054 kernel: acpiphp: Slot [0-5] registered Jun 30 23:42:55 np0000004054 kernel: pci 0000:06:00.0: [1af4:1044] type 00 class 0x00ff00 PCIe Endpoint Jun 30 23:42:55 np0000004054 kernel: pci 0000:06:00.0: BAR 1 [mem 0xfe200000-0xfe200fff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:06:00.0: BAR 4 [mem 0xc180000000-0xc180003fff 64bit pref] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.4: PCI bridge to [bus 06] Jun 30 23:42:55 np0000004054 kernel: acpiphp: Slot [0-6] registered Jun 30 23:42:55 np0000004054 kernel: pci 0000:07:00.0: [1af4:1041] type 00 class 0x020000 PCIe Endpoint Jun 30 23:42:55 np0000004054 kernel: pci 0000:07:00.0: BAR 1 [mem 0xfe080000-0xfe080fff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:07:00.0: BAR 4 [mem 0xc160000000-0xc160003fff 64bit pref] Jun 30 23:42:55 np0000004054 kernel: pci 0000:07:00.0: ROM [mem 0xfe000000-0xfe07ffff pref] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.5: PCI bridge to [bus 07] Jun 30 23:42:55 np0000004054 kernel: acpiphp: Slot [0-7] registered Jun 30 23:42:55 np0000004054 kernel: pci 0000:08:00.0: [1af4:1041] type 00 class 0x020000 PCIe Endpoint Jun 30 23:42:55 np0000004054 kernel: pci 0000:08:00.0: BAR 1 [mem 0xfde80000-0xfde80fff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:08:00.0: BAR 4 [mem 0xc140000000-0xc140003fff 64bit pref] Jun 30 23:42:55 np0000004054 kernel: pci 0000:08:00.0: ROM [mem 0xfde00000-0xfde7ffff pref] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.6: PCI bridge to [bus 08] Jun 30 23:42:55 np0000004054 kernel: acpiphp: Slot [0-8] registered Jun 30 23:42:55 np0000004054 kernel: pci 0000:09:00.0: [1af4:1041] type 00 class 0x020000 PCIe Endpoint Jun 30 23:42:55 np0000004054 kernel: pci 0000:09:00.0: BAR 1 [mem 0xfdc80000-0xfdc80fff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:09:00.0: BAR 4 [mem 0xc120000000-0xc120003fff 64bit pref] Jun 30 23:42:55 np0000004054 kernel: pci 0000:09:00.0: ROM [mem 0xfdc00000-0xfdc7ffff pref] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.7: PCI bridge to [bus 09] Jun 30 23:42:55 np0000004054 kernel: acpiphp: Slot [0-9] registered Jun 30 23:42:55 np0000004054 kernel: pci 0000:0a:00.0: [1af4:1041] type 00 class 0x020000 PCIe Endpoint Jun 30 23:42:55 np0000004054 kernel: pci 0000:0a:00.0: BAR 1 [mem 0xfda80000-0xfda80fff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:0a:00.0: BAR 4 [mem 0xc100000000-0xc100003fff 64bit pref] Jun 30 23:42:55 np0000004054 kernel: pci 0000:0a:00.0: ROM [mem 0xfda00000-0xfda7ffff pref] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.0: PCI bridge to [bus 0a] Jun 30 23:42:55 np0000004054 kernel: acpiphp: Slot [0-10] registered Jun 30 23:42:55 np0000004054 kernel: pci 0000:0b:00.0: [1af4:1041] type 00 class 0x020000 PCIe Endpoint Jun 30 23:42:55 np0000004054 kernel: pci 0000:0b:00.0: BAR 1 [mem 0xfd880000-0xfd880fff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:0b:00.0: BAR 4 [mem 0xc0e0000000-0xc0e0003fff 64bit pref] Jun 30 23:42:55 np0000004054 kernel: pci 0000:0b:00.0: ROM [mem 0xfd800000-0xfd87ffff pref] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.1: PCI bridge to [bus 0b] Jun 30 23:42:55 np0000004054 kernel: acpiphp: Slot [0-11] registered Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.2: PCI bridge to [bus 0c] Jun 30 23:42:55 np0000004054 kernel: acpiphp: Slot [0-12] registered Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.3: PCI bridge to [bus 0d] Jun 30 23:42:55 np0000004054 kernel: acpiphp: Slot [0-13] registered Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.4: PCI bridge to [bus 0e] Jun 30 23:42:55 np0000004054 kernel: acpiphp: Slot [0-14] registered Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.5: PCI bridge to [bus 0f] Jun 30 23:42:55 np0000004054 kernel: acpiphp: Slot [0-15] registered Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.6: PCI bridge to [bus 10] Jun 30 23:42:55 np0000004054 kernel: acpiphp: Slot [0-16] registered Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.7: PCI bridge to [bus 11] Jun 30 23:42:55 np0000004054 kernel: acpiphp: Slot [0-17] registered Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:04.0: PCI bridge to [bus 12] Jun 30 23:42:55 np0000004054 kernel: ACPI: PCI: Interrupt link LNKA configured for IRQ 10 Jun 30 23:42:55 np0000004054 kernel: ACPI: PCI: Interrupt link LNKB configured for IRQ 10 Jun 30 23:42:55 np0000004054 kernel: ACPI: PCI: Interrupt link LNKC configured for IRQ 11 Jun 30 23:42:55 np0000004054 kernel: ACPI: PCI: Interrupt link LNKD configured for IRQ 11 Jun 30 23:42:55 np0000004054 kernel: ACPI: PCI: Interrupt link LNKE configured for IRQ 10 Jun 30 23:42:55 np0000004054 kernel: ACPI: PCI: Interrupt link LNKF configured for IRQ 10 Jun 30 23:42:55 np0000004054 kernel: ACPI: PCI: Interrupt link LNKG configured for IRQ 11 Jun 30 23:42:55 np0000004054 kernel: ACPI: PCI: Interrupt link LNKH configured for IRQ 11 Jun 30 23:42:55 np0000004054 kernel: ACPI: PCI: Interrupt link GSIA configured for IRQ 16 Jun 30 23:42:55 np0000004054 kernel: ACPI: PCI: Interrupt link GSIB configured for IRQ 17 Jun 30 23:42:55 np0000004054 kernel: ACPI: PCI: Interrupt link GSIC configured for IRQ 18 Jun 30 23:42:55 np0000004054 kernel: ACPI: PCI: Interrupt link GSID configured for IRQ 19 Jun 30 23:42:55 np0000004054 kernel: ACPI: PCI: Interrupt link GSIE configured for IRQ 20 Jun 30 23:42:55 np0000004054 kernel: ACPI: PCI: Interrupt link GSIF configured for IRQ 21 Jun 30 23:42:55 np0000004054 kernel: ACPI: PCI: Interrupt link GSIG configured for IRQ 22 Jun 30 23:42:55 np0000004054 kernel: ACPI: PCI: Interrupt link GSIH configured for IRQ 23 Jun 30 23:42:55 np0000004054 kernel: iommu: Default domain type: Translated Jun 30 23:42:55 np0000004054 kernel: iommu: DMA domain TLB invalidation policy: lazy mode Jun 30 23:42:55 np0000004054 kernel: SCSI subsystem initialized Jun 30 23:42:55 np0000004054 kernel: libata version 3.00 loaded. Jun 30 23:42:55 np0000004054 kernel: ACPI: bus type USB registered Jun 30 23:42:55 np0000004054 kernel: usbcore: registered new interface driver usbfs Jun 30 23:42:55 np0000004054 kernel: usbcore: registered new interface driver hub Jun 30 23:42:55 np0000004054 kernel: usbcore: registered new device driver usb Jun 30 23:42:55 np0000004054 kernel: pps_core: LinuxPPS API ver. 1 registered Jun 30 23:42:55 np0000004054 kernel: pps_core: Software ver. 5.3.6 - Copyright 2005-2007 Rodolfo Giometti Jun 30 23:42:55 np0000004054 kernel: PTP clock support registered Jun 30 23:42:55 np0000004054 kernel: EDAC MC: Ver: 3.0.0 Jun 30 23:42:55 np0000004054 kernel: NetLabel: Initializing Jun 30 23:42:55 np0000004054 kernel: NetLabel: domain hash size = 128 Jun 30 23:42:55 np0000004054 kernel: NetLabel: protocols = UNLABELED CIPSOv4 CALIPSO Jun 30 23:42:55 np0000004054 kernel: NetLabel: unlabeled traffic allowed by default Jun 30 23:42:55 np0000004054 kernel: mctp: management component transport protocol core Jun 30 23:42:55 np0000004054 kernel: NET: Registered PF_MCTP protocol family Jun 30 23:42:55 np0000004054 kernel: PCI: Using ACPI for IRQ routing Jun 30 23:42:55 np0000004054 kernel: PCI: pci_cache_line_size set to 64 bytes Jun 30 23:42:55 np0000004054 kernel: e820: reserve RAM buffer [mem 0x0009fc00-0x0009ffff] Jun 30 23:42:55 np0000004054 kernel: e820: reserve RAM buffer [mem 0x7ffdb000-0x7fffffff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:01.0: vgaarb: setting as boot VGA device Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:01.0: vgaarb: bridge control possible Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:01.0: vgaarb: VGA device added: decodes=io+mem,owns=io+mem,locks=none Jun 30 23:42:55 np0000004054 kernel: vgaarb: loaded Jun 30 23:42:55 np0000004054 kernel: clocksource: Switched to clocksource kvm-clock Jun 30 23:42:55 np0000004054 kernel: VFS: Disk quotas dquot_6.6.0 Jun 30 23:42:55 np0000004054 kernel: VFS: Dquot-cache hash table entries: 512 (order 0, 4096 bytes) Jun 30 23:42:55 np0000004054 kernel: AppArmor: AppArmor Filesystem Enabled Jun 30 23:42:55 np0000004054 kernel: pnp: PnP ACPI init Jun 30 23:42:55 np0000004054 kernel: system 00:04: [mem 0xb0000000-0xbfffffff window] has been reserved Jun 30 23:42:55 np0000004054 kernel: pnp: PnP ACPI: found 5 devices Jun 30 23:42:55 np0000004054 kernel: clocksource: acpi_pm: mask: 0xffffff max_cycles: 0xffffff, max_idle_ns: 2085701024 ns Jun 30 23:42:55 np0000004054 kernel: NET: Registered PF_INET protocol family Jun 30 23:42:55 np0000004054 kernel: IP idents hash table entries: 262144 (order: 9, 2097152 bytes, linear) Jun 30 23:42:55 np0000004054 kernel: tcp_listen_portaddr_hash hash table entries: 16384 (order: 6, 262144 bytes, linear) Jun 30 23:42:55 np0000004054 kernel: Table-perturb hash table entries: 65536 (order: 6, 262144 bytes, linear) Jun 30 23:42:55 np0000004054 kernel: TCP established hash table entries: 262144 (order: 9, 2097152 bytes, linear) Jun 30 23:42:55 np0000004054 kernel: TCP bind hash table entries: 65536 (order: 9, 2097152 bytes, linear) Jun 30 23:42:55 np0000004054 kernel: TCP: Hash tables configured (established 262144 bind 65536) Jun 30 23:42:55 np0000004054 kernel: MPTCP token hash table entries: 32768 (order: 8, 786432 bytes, linear) Jun 30 23:42:55 np0000004054 kernel: UDP hash table entries: 16384 (order: 7, 524288 bytes, linear) Jun 30 23:42:55 np0000004054 kernel: UDP-Lite hash table entries: 16384 (order: 7, 524288 bytes, linear) Jun 30 23:42:55 np0000004054 kernel: NET: Registered PF_UNIX/PF_LOCAL protocol family Jun 30 23:42:55 np0000004054 kernel: NET: Registered PF_XDP protocol family Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.1: bridge window [io 0x1000-0x0fff] to [bus 03] add_size 1000 Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.2: bridge window [io 0x1000-0x0fff] to [bus 04] add_size 1000 Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.3: bridge window [io 0x1000-0x0fff] to [bus 05] add_size 1000 Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.4: bridge window [io 0x1000-0x0fff] to [bus 06] add_size 1000 Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.5: bridge window [io 0x1000-0x0fff] to [bus 07] add_size 1000 Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.6: bridge window [io 0x1000-0x0fff] to [bus 08] add_size 1000 Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.7: bridge window [io 0x1000-0x0fff] to [bus 09] add_size 1000 Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.0: bridge window [io 0x1000-0x0fff] to [bus 0a] add_size 1000 Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.1: bridge window [io 0x1000-0x0fff] to [bus 0b] add_size 1000 Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.2: bridge window [io 0x1000-0x0fff] to [bus 0c] add_size 1000 Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.3: bridge window [io 0x1000-0x0fff] to [bus 0d] add_size 1000 Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.4: bridge window [io 0x1000-0x0fff] to [bus 0e] add_size 1000 Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.5: bridge window [io 0x1000-0x0fff] to [bus 0f] add_size 1000 Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.6: bridge window [io 0x1000-0x0fff] to [bus 10] add_size 1000 Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.7: bridge window [io 0x1000-0x0fff] to [bus 11] add_size 1000 Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:04.0: bridge window [io 0x1000-0x0fff] to [bus 12] add_size 1000 Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.1: bridge window [io 0x1000-0x1fff]: assigned Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.2: bridge window [io 0x2000-0x2fff]: assigned Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.3: bridge window [io 0x3000-0x3fff]: assigned Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.4: bridge window [io 0x4000-0x4fff]: assigned Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.5: bridge window [io 0x5000-0x5fff]: assigned Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.6: bridge window [io 0x6000-0x6fff]: assigned Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.7: bridge window [io 0x7000-0x7fff]: assigned Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.0: bridge window [io 0x8000-0x8fff]: assigned Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.1: bridge window [io 0x9000-0x9fff]: assigned Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.2: bridge window [io 0xa000-0xafff]: assigned Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.3: bridge window [io 0xb000-0xbfff]: assigned Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.4: bridge window [io 0xe000-0xefff]: assigned Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.5: bridge window [io 0xf000-0xffff]: assigned Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.6: bridge window [io size 0x1000]: can't assign; no space Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.6: bridge window [io size 0x1000]: failed to assign Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.7: bridge window [io size 0x1000]: can't assign; no space Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.7: bridge window [io size 0x1000]: failed to assign Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:04.0: bridge window [io size 0x1000]: can't assign; no space Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:04.0: bridge window [io size 0x1000]: failed to assign Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:04.0: bridge window [io 0x1000-0x1fff]: assigned Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.7: bridge window [io 0x2000-0x2fff]: assigned Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.6: bridge window [io 0x3000-0x3fff]: assigned Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.5: bridge window [io 0x4000-0x4fff]: assigned Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.4: bridge window [io 0x5000-0x5fff]: assigned Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.3: bridge window [io 0x6000-0x6fff]: assigned Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.2: bridge window [io 0x7000-0x7fff]: assigned Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.1: bridge window [io 0x8000-0x8fff]: assigned Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.0: bridge window [io 0x9000-0x9fff]: assigned Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.7: bridge window [io 0xa000-0xafff]: assigned Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.6: bridge window [io 0xb000-0xbfff]: assigned Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.5: bridge window [io 0xe000-0xefff]: assigned Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.4: bridge window [io 0xf000-0xffff]: assigned Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.3: bridge window [io size 0x1000]: can't assign; no space Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.3: bridge window [io size 0x1000]: failed to assign Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.2: bridge window [io size 0x1000]: can't assign; no space Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.2: bridge window [io size 0x1000]: failed to assign Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.1: bridge window [io size 0x1000]: can't assign; no space Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.1: bridge window [io size 0x1000]: failed to assign Jun 30 23:42:55 np0000004054 kernel: pci 0000:01:00.0: PCI bridge to [bus 02] Jun 30 23:42:55 np0000004054 kernel: pci 0000:01:00.0: bridge window [io 0xc000-0xcfff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:01:00.0: bridge window [mem 0xfc600000-0xfc7fffff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:01:00.0: bridge window [mem 0xc200000000-0xc21fffffff 64bit pref] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.0: PCI bridge to [bus 01-02] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.0: bridge window [io 0xc000-0xcfff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.0: bridge window [mem 0xfc600000-0xfc9fffff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.0: bridge window [mem 0xc200000000-0xc21fffffff 64bit pref] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.1: PCI bridge to [bus 03] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.1: bridge window [mem 0xfe800000-0xfe9fffff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.1: bridge window [mem 0xc1e0000000-0xc1ffffffff 64bit pref] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.2: PCI bridge to [bus 04] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.2: bridge window [mem 0xfe600000-0xfe7fffff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.2: bridge window [mem 0xc1c0000000-0xc1dfffffff 64bit pref] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.3: PCI bridge to [bus 05] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.3: bridge window [mem 0xfe400000-0xfe5fffff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.3: bridge window [mem 0xc1a0000000-0xc1bfffffff 64bit pref] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.4: PCI bridge to [bus 06] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.4: bridge window [io 0xf000-0xffff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.4: bridge window [mem 0xfe200000-0xfe3fffff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.4: bridge window [mem 0xc180000000-0xc19fffffff 64bit pref] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.5: PCI bridge to [bus 07] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.5: bridge window [io 0xe000-0xefff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.5: bridge window [mem 0xfe000000-0xfe1fffff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.5: bridge window [mem 0xc160000000-0xc17fffffff 64bit pref] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.6: PCI bridge to [bus 08] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.6: bridge window [io 0xb000-0xbfff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.6: bridge window [mem 0xfde00000-0xfdffffff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.6: bridge window [mem 0xc140000000-0xc15fffffff 64bit pref] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.7: PCI bridge to [bus 09] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.7: bridge window [io 0xa000-0xafff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.7: bridge window [mem 0xfdc00000-0xfddfffff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:02.7: bridge window [mem 0xc120000000-0xc13fffffff 64bit pref] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.0: PCI bridge to [bus 0a] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.0: bridge window [io 0x9000-0x9fff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.0: bridge window [mem 0xfda00000-0xfdbfffff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.0: bridge window [mem 0xc100000000-0xc11fffffff 64bit pref] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.1: PCI bridge to [bus 0b] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.1: bridge window [io 0x8000-0x8fff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.1: bridge window [mem 0xfd800000-0xfd9fffff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.1: bridge window [mem 0xc0e0000000-0xc0ffffffff 64bit pref] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.2: PCI bridge to [bus 0c] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.2: bridge window [io 0x7000-0x7fff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.2: bridge window [mem 0xfd600000-0xfd7fffff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.2: bridge window [mem 0xc0c0000000-0xc0dfffffff 64bit pref] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.3: PCI bridge to [bus 0d] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.3: bridge window [io 0x6000-0x6fff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.3: bridge window [mem 0xfd400000-0xfd5fffff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.3: bridge window [mem 0xc0a0000000-0xc0bfffffff 64bit pref] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.4: PCI bridge to [bus 0e] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.4: bridge window [io 0x5000-0x5fff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.4: bridge window [mem 0xfd200000-0xfd3fffff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.4: bridge window [mem 0xc080000000-0xc09fffffff 64bit pref] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.5: PCI bridge to [bus 0f] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.5: bridge window [io 0x4000-0x4fff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.5: bridge window [mem 0xfd000000-0xfd1fffff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.5: bridge window [mem 0xc060000000-0xc07fffffff 64bit pref] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.6: PCI bridge to [bus 10] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.6: bridge window [io 0x3000-0x3fff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.6: bridge window [mem 0xfce00000-0xfcffffff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.6: bridge window [mem 0xc040000000-0xc05fffffff 64bit pref] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.7: PCI bridge to [bus 11] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.7: bridge window [io 0x2000-0x2fff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.7: bridge window [mem 0xfcc00000-0xfcdfffff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:03.7: bridge window [mem 0xc020000000-0xc03fffffff 64bit pref] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:04.0: PCI bridge to [bus 12] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:04.0: bridge window [io 0x1000-0x1fff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:04.0: bridge window [mem 0xfca00000-0xfcbfffff] Jun 30 23:42:55 np0000004054 kernel: pci 0000:00:04.0: bridge window [mem 0xc000000000-0xc01fffffff 64bit pref] Jun 30 23:42:55 np0000004054 kernel: pci_bus 0000:00: resource 4 [io 0x0000-0x0cf7 window] Jun 30 23:42:55 np0000004054 kernel: pci_bus 0000:00: resource 5 [io 0x0d00-0xffff window] Jun 30 23:42:55 np0000004054 kernel: pci_bus 0000:00: resource 6 [mem 0x000a0000-0x000bffff window] Jun 30 23:42:55 np0000004054 kernel: pci_bus 0000:00: resource 7 [mem 0x80000000-0xafffffff window] Jun 30 23:42:55 np0000004054 kernel: pci_bus 0000:00: resource 8 [mem 0xc0000000-0xfebfffff window] Jun 30 23:42:55 np0000004054 kernel: pci_bus 0000:00: resource 9 [mem 0xc000000000-0xc7ffffffff window] Jun 30 23:42:55 np0000004054 kernel: pci_bus 0000:01: resource 0 [io 0xc000-0xcfff] Jun 30 23:42:55 np0000004054 kernel: pci_bus 0000:01: resource 1 [mem 0xfc600000-0xfc9fffff] Jun 30 23:42:55 np0000004054 kernel: pci_bus 0000:01: resource 2 [mem 0xc200000000-0xc21fffffff 64bit pref] Jun 30 23:42:55 np0000004054 kernel: pci_bus 0000:02: resource 0 [io 0xc000-0xcfff] Jun 30 23:42:55 np0000004054 kernel: pci_bus 0000:02: resource 1 [mem 0xfc600000-0xfc7fffff] Jun 30 23:42:55 np0000004054 kernel: pci_bus 0000:02: resource 2 [mem 0xc200000000-0xc21fffffff 64bit pref] Jun 30 23:42:55 np0000004054 kernel: pci_bus 0000:03: resource 1 [mem 0xfe800000-0xfe9fffff] Jun 30 23:42:55 np0000004054 kernel: pci_bus 0000:03: resource 2 [mem 0xc1e0000000-0xc1ffffffff 64bit pref] Jun 30 23:42:55 np0000004054 kernel: pci_bus 0000:04: resource 1 [mem 0xfe600000-0xfe7fffff] Jun 30 23:42:55 np0000004054 kernel: pci_bus 0000:04: resource 2 [mem 0xc1c0000000-0xc1dfffffff 64bit pref] Jun 30 23:42:55 np0000004054 kernel: pci_bus 0000:05: resource 1 [mem 0xfe400000-0xfe5fffff] Jun 30 23:42:55 np0000004054 kernel: pci_bus 0000:05: resource 2 [mem 0xc1a0000000-0xc1bfffffff 64bit pref] Jun 30 23:42:55 np0000004054 kernel: pci_bus 0000:06: resource 0 [io 0xf000-0xffff] Jun 30 23:42:55 np0000004054 kernel: pci_bus 0000:06: resource 1 [mem 0xfe200000-0xfe3fffff] Jun 30 23:42:55 np0000004054 kernel: pci_bus 0000:06: resource 2 [mem 0xc180000000-0xc19fffffff 64bit pref] Jun 30 23:42:55 np0000004054 kernel: pci_bus 0000:07: resource 0 [io 0xe000-0xefff] Jun 30 23:42:55 np0000004054 kernel: pci_bus 0000:07: resource 1 [mem 0xfe000000-0xfe1fffff] Jun 30 23:42:55 np0000004054 kernel: pci_bus 0000:07: resource 2 [mem 0xc160000000-0xc17fffffff 64bit pref] Jun 30 23:42:55 np0000004054 kernel: pci_bus 0000:08: resource 0 [io 0xb000-0xbfff] Jun 30 23:42:55 np0000004054 kernel: pci_bus 0000:08: resource 1 [mem 0xfde00000-0xfdffffff] Jun 30 23:42:55 np0000004054 kernel: pci_bus 0000:08: resource 2 [mem 0xc140000000-0xc15fffffff 64bit pref] Jun 30 23:42:55 np0000004054 kernel: pci_bus 0000:09: resource 0 [io 0xa000-0xafff] Jun 30 23:42:55 np0000004054 kernel: pci_bus 0000:09: resource 1 [mem 0xfdc00000-0xfddfffff] Jun 30 23:42:55 np0000004054 kernel: pci_bus 0000:09: resource 2 [mem 0xc120000000-0xc13fffffff 64bit pref] Jun 30 23:42:55 np0000004054 kernel: pci_bus 0000:0a: resource 0 [io 0x9000-0x9fff] Jun 30 23:42:55 np0000004054 kernel: pci_bus 0000:0a: resource 1 [mem 0xfda00000-0xfdbfffff] Jun 30 23:42:55 np0000004054 kernel: pci_bus 0000:0a: resource 2 [mem 0xc100000000-0xc11fffffff 64bit pref] Jun 30 23:42:55 np0000004054 kernel: pci_bus 0000:0b: resource 0 [io 0x8000-0x8fff] Jun 30 23:42:55 np0000004054 kernel: pci_bus 0000:0b: resource 1 [mem 0xfd800000-0xfd9fffff] Jun 30 23:42:55 np0000004054 kernel: pci_bus 0000:0b: resource 2 [mem 0xc0e0000000-0xc0ffffffff 64bit pref] Jun 30 23:42:55 np0000004054 kernel: pci_bus 0000:0c: resource 0 [io 0x7000-0x7fff] Jun 30 23:42:55 np0000004054 kernel: pci_bus 0000:0c: resource 1 [mem 0xfd600000-0xfd7fffff] Jun 30 23:42:55 np0000004054 kernel: pci_bus 0000:0c: resource 2 [mem 0xc0c0000000-0xc0dfffffff 64bit pref] Jun 30 23:42:55 np0000004054 kernel: pci_bus 0000:0d: resource 0 [io 0x6000-0x6fff] Jun 30 23:42:55 np0000004054 kernel: pci_bus 0000:0d: resource 1 [mem 0xfd400000-0xfd5fffff] Jun 30 23:42:55 np0000004054 kernel: pci_bus 0000:0d: resource 2 [mem 0xc0a0000000-0xc0bfffffff 64bit pref] Jun 30 23:42:55 np0000004054 kernel: pci_bus 0000:0e: resource 0 [io 0x5000-0x5fff] Jun 30 23:42:55 np0000004054 kernel: pci_bus 0000:0e: resource 1 [mem 0xfd200000-0xfd3fffff] Jun 30 23:42:55 np0000004054 kernel: pci_bus 0000:0e: resource 2 [mem 0xc080000000-0xc09fffffff 64bit pref] Jun 30 23:42:55 np0000004054 kernel: pci_bus 0000:0f: resource 0 [io 0x4000-0x4fff] Jun 30 23:42:55 np0000004054 kernel: pci_bus 0000:0f: resource 1 [mem 0xfd000000-0xfd1fffff] Jun 30 23:42:55 np0000004054 kernel: pci_bus 0000:0f: resource 2 [mem 0xc060000000-0xc07fffffff 64bit pref] Jun 30 23:42:55 np0000004054 kernel: pci_bus 0000:10: resource 0 [io 0x3000-0x3fff] Jun 30 23:42:55 np0000004054 kernel: pci_bus 0000:10: resource 1 [mem 0xfce00000-0xfcffffff] Jun 30 23:42:55 np0000004054 kernel: pci_bus 0000:10: resource 2 [mem 0xc040000000-0xc05fffffff 64bit pref] Jun 30 23:42:55 np0000004054 kernel: pci_bus 0000:11: resource 0 [io 0x2000-0x2fff] Jun 30 23:42:55 np0000004054 kernel: pci_bus 0000:11: resource 1 [mem 0xfcc00000-0xfcdfffff] Jun 30 23:42:55 np0000004054 kernel: pci_bus 0000:11: resource 2 [mem 0xc020000000-0xc03fffffff 64bit pref] Jun 30 23:42:55 np0000004054 kernel: pci_bus 0000:12: resource 0 [io 0x1000-0x1fff] Jun 30 23:42:55 np0000004054 kernel: pci_bus 0000:12: resource 1 [mem 0xfca00000-0xfcbfffff] Jun 30 23:42:55 np0000004054 kernel: pci_bus 0000:12: resource 2 [mem 0xc000000000-0xc01fffffff 64bit pref] Jun 30 23:42:55 np0000004054 kernel: ACPI: \_SB_.GSIG: Enabled at IRQ 22 Jun 30 23:42:55 np0000004054 kernel: PCI: CLS 0 bytes, default 64 Jun 30 23:42:55 np0000004054 kernel: Trying to unpack rootfs image as initramfs... Jun 30 23:42:55 np0000004054 kernel: PCI-DMA: Using software bounce buffering for IO (SWIOTLB) Jun 30 23:42:55 np0000004054 kernel: software IO TLB: mapped [mem 0x000000003b000000-0x000000003f000000] (64MB) Jun 30 23:42:55 np0000004054 kernel: Initialise system trusted keyrings Jun 30 23:42:55 np0000004054 kernel: Key type blacklist registered Jun 30 23:42:55 np0000004054 kernel: workingset: timestamp_bits=36 max_order=23 bucket_order=0 Jun 30 23:42:55 np0000004054 kernel: zbud: loaded Jun 30 23:42:55 np0000004054 kernel: squashfs: version 4.0 (2009/01/31) Phillip Lougher Jun 30 23:42:55 np0000004054 kernel: fuse: init (API version 7.39) Jun 30 23:42:55 np0000004054 kernel: integrity: Platform Keyring initialized Jun 30 23:42:55 np0000004054 kernel: integrity: Machine keyring initialized Jun 30 23:42:55 np0000004054 kernel: Key type asymmetric registered Jun 30 23:42:55 np0000004054 kernel: Asymmetric key parser 'x509' registered Jun 30 23:42:55 np0000004054 kernel: Block layer SCSI generic (bsg) driver version 0.4 loaded (major 243) Jun 30 23:42:55 np0000004054 kernel: io scheduler mq-deadline registered Jun 30 23:42:55 np0000004054 kernel: pcieport 0000:00:02.0: PME: Signaling with IRQ 24 Jun 30 23:42:55 np0000004054 kernel: pcieport 0000:00:02.0: AER: enabled with IRQ 24 Jun 30 23:42:55 np0000004054 kernel: pcieport 0000:00:02.1: PME: Signaling with IRQ 25 Jun 30 23:42:55 np0000004054 kernel: pcieport 0000:00:02.1: AER: enabled with IRQ 25 Jun 30 23:42:55 np0000004054 kernel: pcieport 0000:00:02.2: PME: Signaling with IRQ 26 Jun 30 23:42:55 np0000004054 kernel: pcieport 0000:00:02.2: AER: enabled with IRQ 26 Jun 30 23:42:55 np0000004054 kernel: pcieport 0000:00:02.3: PME: Signaling with IRQ 27 Jun 30 23:42:55 np0000004054 kernel: pcieport 0000:00:02.3: AER: enabled with IRQ 27 Jun 30 23:42:55 np0000004054 kernel: pcieport 0000:00:02.4: PME: Signaling with IRQ 28 Jun 30 23:42:55 np0000004054 kernel: pcieport 0000:00:02.4: AER: enabled with IRQ 28 Jun 30 23:42:55 np0000004054 kernel: pcieport 0000:00:02.5: PME: Signaling with IRQ 29 Jun 30 23:42:55 np0000004054 kernel: pcieport 0000:00:02.5: AER: enabled with IRQ 29 Jun 30 23:42:55 np0000004054 kernel: pcieport 0000:00:02.6: PME: Signaling with IRQ 30 Jun 30 23:42:55 np0000004054 kernel: pcieport 0000:00:02.6: AER: enabled with IRQ 30 Jun 30 23:42:55 np0000004054 kernel: pcieport 0000:00:02.7: PME: Signaling with IRQ 31 Jun 30 23:42:55 np0000004054 kernel: pcieport 0000:00:02.7: AER: enabled with IRQ 31 Jun 30 23:42:55 np0000004054 kernel: ACPI: \_SB_.GSIH: Enabled at IRQ 23 Jun 30 23:42:55 np0000004054 kernel: pcieport 0000:00:03.0: PME: Signaling with IRQ 32 Jun 30 23:42:55 np0000004054 kernel: pcieport 0000:00:03.0: AER: enabled with IRQ 32 Jun 30 23:42:55 np0000004054 kernel: pcieport 0000:00:03.1: PME: Signaling with IRQ 33 Jun 30 23:42:55 np0000004054 kernel: pcieport 0000:00:03.1: AER: enabled with IRQ 33 Jun 30 23:42:55 np0000004054 kernel: pcieport 0000:00:03.2: PME: Signaling with IRQ 34 Jun 30 23:42:55 np0000004054 kernel: pcieport 0000:00:03.2: AER: enabled with IRQ 34 Jun 30 23:42:55 np0000004054 kernel: pcieport 0000:00:03.3: PME: Signaling with IRQ 35 Jun 30 23:42:55 np0000004054 kernel: pcieport 0000:00:03.3: AER: enabled with IRQ 35 Jun 30 23:42:55 np0000004054 kernel: pcieport 0000:00:03.4: PME: Signaling with IRQ 36 Jun 30 23:42:55 np0000004054 kernel: pcieport 0000:00:03.4: AER: enabled with IRQ 36 Jun 30 23:42:55 np0000004054 kernel: pcieport 0000:00:03.5: PME: Signaling with IRQ 37 Jun 30 23:42:55 np0000004054 kernel: pcieport 0000:00:03.5: AER: enabled with IRQ 37 Jun 30 23:42:55 np0000004054 kernel: Freeing initrd memory: 30320K Jun 30 23:42:55 np0000004054 kernel: pcieport 0000:00:03.6: PME: Signaling with IRQ 38 Jun 30 23:42:55 np0000004054 kernel: pcieport 0000:00:03.6: AER: enabled with IRQ 38 Jun 30 23:42:55 np0000004054 kernel: pcieport 0000:00:03.7: PME: Signaling with IRQ 39 Jun 30 23:42:55 np0000004054 kernel: pcieport 0000:00:03.7: AER: enabled with IRQ 39 Jun 30 23:42:55 np0000004054 kernel: ACPI: \_SB_.GSIE: Enabled at IRQ 20 Jun 30 23:42:55 np0000004054 kernel: pcieport 0000:00:04.0: PME: Signaling with IRQ 40 Jun 30 23:42:55 np0000004054 kernel: pcieport 0000:00:04.0: AER: enabled with IRQ 40 Jun 30 23:42:55 np0000004054 kernel: shpchp 0000:01:00.0: HPC vendor_id 1b36 device_id e ss_vid 0 ss_did 0 Jun 30 23:42:55 np0000004054 kernel: shpchp 0000:01:00.0: pci_hp_register failed with error -16 Jun 30 23:42:55 np0000004054 kernel: shpchp 0000:01:00.0: Slot initialization failed Jun 30 23:42:55 np0000004054 kernel: shpchp: Standard Hot Plug PCI Controller Driver version: 0.4 Jun 30 23:42:55 np0000004054 kernel: Driver imsttfb not loading because of nomodeset parameter Jun 30 23:42:55 np0000004054 kernel: Driver asiliantfb not loading because of nomodeset parameter Jun 30 23:42:55 np0000004054 kernel: input: Power Button as /devices/LNXSYSTM:00/LNXPWRBN:00/input/input0 Jun 30 23:42:55 np0000004054 kernel: ACPI: button: Power Button [PWRF] Jun 30 23:42:55 np0000004054 kernel: ACPI: \_SB_.GSIF: Enabled at IRQ 21 Jun 30 23:42:55 np0000004054 kernel: Free page reporting enabled Jun 30 23:42:55 np0000004054 kernel: Serial: 8250/16550 driver, 32 ports, IRQ sharing enabled Jun 30 23:42:55 np0000004054 kernel: 00:00: ttyS0 at I/O 0x3f8 (irq = 4, base_baud = 115200) is a 16550A Jun 30 23:42:55 np0000004054 kernel: Linux agpgart interface v0.103 Jun 30 23:42:55 np0000004054 kernel: loop: module loaded Jun 30 23:42:55 np0000004054 kernel: virtio_scsi virtio2: 12/0/0 default/read/poll queues Jun 30 23:42:55 np0000004054 kernel: scsi host0: Virtio SCSI HBA Jun 30 23:42:55 np0000004054 kernel: ACPI: bus type drm_connector registered Jun 30 23:42:55 np0000004054 kernel: scsi 0:0:0:0: Direct-Access QEMU QEMU HARDDISK 2.5+ PQ: 0 ANSI: 5 Jun 30 23:42:55 np0000004054 kernel: tun: Universal TUN/TAP device driver, 1.6 Jun 30 23:42:55 np0000004054 kernel: scsi 0:0:0:1: Direct-Access QEMU QEMU HARDDISK 2.5+ PQ: 0 ANSI: 5 Jun 30 23:42:55 np0000004054 kernel: PPP generic driver version 2.4.2 Jun 30 23:42:55 np0000004054 kernel: uhci_hcd 0000:02:01.0: UHCI Host Controller Jun 30 23:42:55 np0000004054 kernel: uhci_hcd 0000:02:01.0: new USB bus registered, assigned bus number 1 Jun 30 23:42:55 np0000004054 kernel: uhci_hcd 0000:02:01.0: detected 2 ports Jun 30 23:42:55 np0000004054 kernel: uhci_hcd 0000:02:01.0: irq 22, io port 0x0000c000 Jun 30 23:42:55 np0000004054 kernel: usb usb1: New USB device found, idVendor=1d6b, idProduct=0001, bcdDevice= 6.08 Jun 30 23:42:55 np0000004054 kernel: usb usb1: New USB device strings: Mfr=3, Product=2, SerialNumber=1 Jun 30 23:42:55 np0000004054 kernel: usb usb1: Product: UHCI Host Controller Jun 30 23:42:55 np0000004054 kernel: usb usb1: Manufacturer: Linux 6.8.0-124-generic uhci_hcd Jun 30 23:42:55 np0000004054 kernel: usb usb1: SerialNumber: 0000:02:01.0 Jun 30 23:42:55 np0000004054 kernel: hub 1-0:1.0: USB hub found Jun 30 23:42:55 np0000004054 kernel: hub 1-0:1.0: 2 ports detected Jun 30 23:42:55 np0000004054 kernel: scsi 0:0:0:0: Attached scsi generic sg0 type 0 Jun 30 23:42:55 np0000004054 kernel: i8042: PNP: PS/2 Controller [PNP0303:KBD,PNP0f13:MOU] at 0x60,0x64 irq 1,12 Jun 30 23:42:55 np0000004054 kernel: sd 0:0:0:0: Power-on or device reset occurred Jun 30 23:42:55 np0000004054 kernel: sd 0:0:0:0: [sda] 209715200 512-byte logical blocks: (107 GB/100 GiB) Jun 30 23:42:55 np0000004054 kernel: serio: i8042 KBD port at 0x60,0x64 irq 1 Jun 30 23:42:55 np0000004054 kernel: sd 0:0:0:0: [sda] Write Protect is off Jun 30 23:42:55 np0000004054 kernel: serio: i8042 AUX port at 0x60,0x64 irq 12 Jun 30 23:42:55 np0000004054 kernel: sd 0:0:0:0: [sda] Mode Sense: 63 00 00 08 Jun 30 23:42:55 np0000004054 kernel: sd 0:0:0:1: Power-on or device reset occurred Jun 30 23:42:55 np0000004054 kernel: sd 0:0:0:0: [sda] Write cache: enabled, read cache: enabled, doesn't support DPO or FUA Jun 30 23:42:55 np0000004054 kernel: sd 0:0:0:1: [sdb] 482344960 512-byte logical blocks: (247 GB/230 GiB) Jun 30 23:42:55 np0000004054 kernel: sda: sda1 sda14 sda15 sda16 Jun 30 23:42:55 np0000004054 kernel: sd 0:0:0:1: [sdb] Write Protect is off Jun 30 23:42:55 np0000004054 kernel: sd 0:0:0:1: Attached scsi generic sg1 type 0 Jun 30 23:42:55 np0000004054 kernel: sd 0:0:0:0: [sda] Attached SCSI disk Jun 30 23:42:55 np0000004054 kernel: sd 0:0:0:1: [sdb] Mode Sense: 63 00 00 08 Jun 30 23:42:55 np0000004054 kernel: mousedev: PS/2 mouse device common for all mice Jun 30 23:42:55 np0000004054 kernel: sd 0:0:0:1: [sdb] Write cache: enabled, read cache: enabled, doesn't support DPO or FUA Jun 30 23:42:55 np0000004054 kernel: rtc_cmos 00:03: RTC can wake from S4 Jun 30 23:42:55 np0000004054 kernel: sd 0:0:0:1: [sdb] Attached SCSI disk Jun 30 23:42:55 np0000004054 kernel: input: AT Translated Set 2 keyboard as /devices/platform/i8042/serio0/input/input1 Jun 30 23:42:55 np0000004054 kernel: rtc_cmos 00:03: registered as rtc0 Jun 30 23:42:55 np0000004054 kernel: rtc_cmos 00:03: setting system clock to 2026-06-30T23:42:53 UTC (1782862973) Jun 30 23:42:55 np0000004054 kernel: rtc_cmos 00:03: alarms up to one day, y3k, 242 bytes nvram Jun 30 23:42:55 np0000004054 kernel: i2c_dev: i2c /dev entries driver Jun 30 23:42:55 np0000004054 kernel: device-mapper: core: CONFIG_IMA_DISABLE_HTABLE is disabled. Duplicate IMA measurements will not be recorded in the IMA log. Jun 30 23:42:55 np0000004054 kernel: device-mapper: uevent: version 1.0.3 Jun 30 23:42:55 np0000004054 kernel: device-mapper: ioctl: 4.48.0-ioctl (2023-03-01) initialised: dm-devel@redhat.com Jun 30 23:42:55 np0000004054 kernel: amd_pstate: the _CPC object is not present in SBIOS or ACPI disabled Jun 30 23:42:55 np0000004054 kernel: ledtrig-cpu: registered to indicate activity on CPUs Jun 30 23:42:55 np0000004054 kernel: drop_monitor: Initializing network drop monitor service Jun 30 23:42:55 np0000004054 kernel: NET: Registered PF_INET6 protocol family Jun 30 23:42:55 np0000004054 kernel: Segment Routing with IPv6 Jun 30 23:42:55 np0000004054 kernel: In-situ OAM (IOAM) with IPv6 Jun 30 23:42:55 np0000004054 kernel: NET: Registered PF_PACKET protocol family Jun 30 23:42:55 np0000004054 kernel: Key type dns_resolver registered Jun 30 23:42:55 np0000004054 kernel: IPI shorthand broadcast: enabled Jun 30 23:42:55 np0000004054 kernel: sched_clock: Marking stable (1072002506, 81138719)->(1219998255, -66857030) Jun 30 23:42:55 np0000004054 kernel: registered taskstats version 1 Jun 30 23:42:55 np0000004054 kernel: Loading compiled-in X.509 certificates Jun 30 23:42:55 np0000004054 kernel: Loaded X.509 cert 'Build time autogenerated kernel key: 78150776d86dbe7b98beeb77e600b45dfdb9d76c' Jun 30 23:42:55 np0000004054 kernel: Loaded X.509 cert 'Canonical Ltd. Live Patch Signing 2025 Kmod: d541cef61dc7e793b7eb7e899970a2eef0b5dc8c' Jun 30 23:42:55 np0000004054 kernel: Loaded X.509 cert 'Canonical Ltd. Live Patch Signing: 14df34d1a87cf37625abec039ef2bf521249b969' Jun 30 23:42:55 np0000004054 kernel: Loaded X.509 cert 'Canonical Ltd. Kernel Module Signing 2025 Kmod: 4627603d2357a2a3f81006370894c221175893e9' Jun 30 23:42:55 np0000004054 kernel: Loaded X.509 cert 'Canonical Ltd. Kernel Module Signing: 88f752e560a1e0737e31163a466ad7b70a850c19' Jun 30 23:42:55 np0000004054 kernel: blacklist: Loading compiled-in revocation X.509 certificates Jun 30 23:42:55 np0000004054 kernel: Loaded X.509 cert 'Canonical Ltd. Secure Boot Signing: 61482aa2830d0ab2ad5af10b7250da9033ddcef0' Jun 30 23:42:55 np0000004054 kernel: Loaded X.509 cert 'Canonical Ltd. Secure Boot Signing (2017): 242ade75ac4a15e50d50c84b0d45ff3eae707a03' Jun 30 23:42:55 np0000004054 kernel: Loaded X.509 cert 'Canonical Ltd. Secure Boot Signing (ESM 2018): 365188c1d374d6b07c3c8f240f8ef722433d6a8b' Jun 30 23:42:55 np0000004054 kernel: Loaded X.509 cert 'Canonical Ltd. Secure Boot Signing (2019): c0746fd6c5da3ae827864651ad66ae47fe24b3e8' Jun 30 23:42:55 np0000004054 kernel: Loaded X.509 cert 'Canonical Ltd. Secure Boot Signing (2021 v1): a8d54bbb3825cfb94fa13c9f8a594a195c107b8d' Jun 30 23:42:55 np0000004054 kernel: Loaded X.509 cert 'Canonical Ltd. Secure Boot Signing (2021 v2): 4cf046892d6fd3c9a5b03f98d845f90851dc6a8c' Jun 30 23:42:55 np0000004054 kernel: Loaded X.509 cert 'Canonical Ltd. Secure Boot Signing (2021 v3): 100437bb6de6e469b581e61cd66bce3ef4ed53af' Jun 30 23:42:55 np0000004054 kernel: Loaded X.509 cert 'Canonical Ltd. Secure Boot Signing (Ubuntu Core 2019): c1d57b8f6b743f23ee41f4f7ee292f06eecadfb9' Jun 30 23:42:55 np0000004054 kernel: Key type .fscrypt registered Jun 30 23:42:55 np0000004054 kernel: Key type fscrypt-provisioning registered Jun 30 23:42:55 np0000004054 kernel: cryptd: max_cpu_qlen set to 1000 Jun 30 23:42:55 np0000004054 kernel: AVX2 version of gcm_enc/dec engaged. Jun 30 23:42:55 np0000004054 kernel: AES CTR mode by8 optimization enabled Jun 30 23:42:55 np0000004054 kernel: Key type encrypted registered Jun 30 23:42:55 np0000004054 kernel: AppArmor: AppArmor sha256 policy hashing enabled Jun 30 23:42:55 np0000004054 kernel: ima: No TPM chip found, activating TPM-bypass! Jun 30 23:42:55 np0000004054 kernel: Loading compiled-in module X.509 certificates Jun 30 23:42:55 np0000004054 kernel: Loaded X.509 cert 'Build time autogenerated kernel key: 78150776d86dbe7b98beeb77e600b45dfdb9d76c' Jun 30 23:42:55 np0000004054 kernel: ima: Allocated hash algorithm: sha256 Jun 30 23:42:55 np0000004054 kernel: ima: No architecture policies found Jun 30 23:42:55 np0000004054 kernel: evm: Initialising EVM extended attributes: Jun 30 23:42:55 np0000004054 kernel: evm: security.selinux Jun 30 23:42:55 np0000004054 kernel: evm: security.SMACK64 Jun 30 23:42:55 np0000004054 kernel: evm: security.SMACK64EXEC Jun 30 23:42:55 np0000004054 kernel: evm: security.SMACK64TRANSMUTE Jun 30 23:42:55 np0000004054 kernel: evm: security.SMACK64MMAP Jun 30 23:42:55 np0000004054 kernel: evm: security.apparmor Jun 30 23:42:55 np0000004054 kernel: evm: security.ima Jun 30 23:42:55 np0000004054 kernel: evm: security.capability Jun 30 23:42:55 np0000004054 kernel: evm: HMAC attrs: 0x1 Jun 30 23:42:55 np0000004054 kernel: PM: Magic number: 14:381:758 Jun 30 23:42:55 np0000004054 kernel: tty ttyS9: hash matches Jun 30 23:42:55 np0000004054 kernel: RAS: Correctable Errors collector initialized. Jun 30 23:42:55 np0000004054 kernel: clk: Disabling unused clocks Jun 30 23:42:55 np0000004054 kernel: Freeing unused decrypted memory: 2028K Jun 30 23:42:55 np0000004054 kernel: Freeing unused kernel image (initmem) memory: 4924K Jun 30 23:42:55 np0000004054 kernel: Write protecting the kernel read-only data: 38912k Jun 30 23:42:55 np0000004054 kernel: Freeing unused kernel image (rodata/data gap) memory: 1968K Jun 30 23:42:55 np0000004054 kernel: x86/mm: Checked W+X mappings: passed, no W+X pages found. Jun 30 23:42:55 np0000004054 kernel: Run /init as init process Jun 30 23:42:55 np0000004054 kernel: with arguments: Jun 30 23:42:55 np0000004054 kernel: /init Jun 30 23:42:55 np0000004054 kernel: nofb Jun 30 23:42:55 np0000004054 kernel: with environment: Jun 30 23:42:55 np0000004054 kernel: HOME=/ Jun 30 23:42:55 np0000004054 kernel: TERM=linux Jun 30 23:42:55 np0000004054 kernel: vga=normal Jun 30 23:42:55 np0000004054 kernel: usb 1-1: new full-speed USB device number 2 using uhci_hcd Jun 30 23:42:55 np0000004054 kernel: virtio_gpu: probe of virtio0 failed with error -22 Jun 30 23:42:55 np0000004054 kernel: usb 1-1: New USB device found, idVendor=0627, idProduct=0001, bcdDevice= 0.00 Jun 30 23:42:55 np0000004054 kernel: usb 1-1: New USB device strings: Mfr=1, Product=3, SerialNumber=10 Jun 30 23:42:55 np0000004054 kernel: usb 1-1: Product: QEMU USB Tablet Jun 30 23:42:55 np0000004054 kernel: usb 1-1: Manufacturer: QEMU Jun 30 23:42:55 np0000004054 kernel: usb 1-1: SerialNumber: 28754-0000:00:02.0:00.0:01.0-1 Jun 30 23:42:55 np0000004054 kernel: ahci 0000:00:1f.2: version 3.0 Jun 30 23:42:55 np0000004054 kernel: ACPI: \_SB_.GSIA: Enabled at IRQ 16 Jun 30 23:42:55 np0000004054 kernel: virtio_net virtio5 enp7s0: renamed from eth1 Jun 30 23:42:55 np0000004054 kernel: ahci 0000:00:1f.2: AHCI 0001.0000 32 slots 6 ports 1.5 Gbps 0x3f impl SATA mode Jun 30 23:42:55 np0000004054 kernel: ahci 0000:00:1f.2: flags: 64bit ncq only Jun 30 23:42:55 np0000004054 kernel: input: VirtualPS/2 VMware VMMouse as /devices/platform/i8042/serio1/input/input4 Jun 30 23:42:55 np0000004054 kernel: virtio_net virtio9 enp11s0: renamed from eth5 Jun 30 23:42:55 np0000004054 kernel: scsi host1: ahci Jun 30 23:42:55 np0000004054 kernel: input: VirtualPS/2 VMware VMMouse as /devices/platform/i8042/serio1/input/input3 Jun 30 23:42:55 np0000004054 kernel: scsi host2: ahci Jun 30 23:42:55 np0000004054 kernel: scsi host3: ahci Jun 30 23:42:55 np0000004054 kernel: virtio_net virtio7 enp9s0: renamed from eth3 Jun 30 23:42:55 np0000004054 kernel: scsi host4: ahci Jun 30 23:42:55 np0000004054 kernel: scsi host5: ahci Jun 30 23:42:55 np0000004054 kernel: scsi host6: ahci Jun 30 23:42:55 np0000004054 kernel: ata1: SATA max UDMA/133 abar m4096@0xfea22000 port 0xfea22100 irq 76 lpm-pol 0 Jun 30 23:42:55 np0000004054 kernel: ata2: SATA max UDMA/133 abar m4096@0xfea22000 port 0xfea22180 irq 76 lpm-pol 0 Jun 30 23:42:55 np0000004054 kernel: ata3: SATA max UDMA/133 abar m4096@0xfea22000 port 0xfea22200 irq 76 lpm-pol 0 Jun 30 23:42:55 np0000004054 kernel: ata4: SATA max UDMA/133 abar m4096@0xfea22000 port 0xfea22280 irq 76 lpm-pol 0 Jun 30 23:42:55 np0000004054 kernel: ata5: SATA max UDMA/133 abar m4096@0xfea22000 port 0xfea22300 irq 76 lpm-pol 0 Jun 30 23:42:55 np0000004054 kernel: hid: raw HID events driver (C) Jiri Kosina Jun 30 23:42:55 np0000004054 kernel: ata6: SATA max UDMA/133 abar m4096@0xfea22000 port 0xfea22380 irq 76 lpm-pol 0 Jun 30 23:42:55 np0000004054 kernel: virtio_net virtio1 enp3s0: renamed from eth0 Jun 30 23:42:55 np0000004054 kernel: usbcore: registered new interface driver usbhid Jun 30 23:42:55 np0000004054 kernel: usbhid: USB HID core driver Jun 30 23:42:55 np0000004054 kernel: virtio_net virtio8 enp10s0: renamed from eth4 Jun 30 23:42:55 np0000004054 kernel: virtio_net virtio6 enp8s0: renamed from eth2 Jun 30 23:42:55 np0000004054 kernel: ata2: SATA link down (SStatus 0 SControl 300) Jun 30 23:42:55 np0000004054 kernel: ata6: SATA link down (SStatus 0 SControl 300) Jun 30 23:42:55 np0000004054 kernel: ata5: SATA link down (SStatus 0 SControl 300) Jun 30 23:42:55 np0000004054 kernel: ata4: SATA link down (SStatus 0 SControl 300) Jun 30 23:42:55 np0000004054 kernel: ata3: SATA link down (SStatus 0 SControl 300) Jun 30 23:42:55 np0000004054 kernel: ata1: SATA link down (SStatus 0 SControl 300) Jun 30 23:42:55 np0000004054 kernel: input: QEMU QEMU USB Tablet as /devices/pci0000:00/0000:00:02.0/0000:01:00.0/0000:02:01.0/usb1/1-1/1-1:1.0/0003:0627:0001.0001/input/input5 Jun 30 23:42:55 np0000004054 kernel: hid-generic 0003:0627:0001.0001: input,hidraw0: USB HID v0.01 Mouse [QEMU QEMU USB Tablet] on usb-0000:02:01.0-1/input0 Jun 30 23:42:55 np0000004054 kernel: raid6: avx2x4 gen() 34028 MB/s Jun 30 23:42:55 np0000004054 kernel: raid6: avx2x2 gen() 31020 MB/s Jun 30 23:42:55 np0000004054 kernel: raid6: avx2x1 gen() 26440 MB/s Jun 30 23:42:55 np0000004054 kernel: raid6: using algorithm avx2x4 gen() 34028 MB/s Jun 30 23:42:55 np0000004054 kernel: raid6: .... xor() 5218 MB/s, rmw enabled Jun 30 23:42:55 np0000004054 kernel: raid6: using avx2x2 recovery algorithm Jun 30 23:42:55 np0000004054 kernel: xor: automatically using best checksumming function avx Jun 30 23:42:55 np0000004054 kernel: async_tx: api initialized (async) Jun 30 23:42:55 np0000004054 kernel: Btrfs loaded, zoned=yes, fsverity=yes Jun 30 23:42:55 np0000004054 kernel: EXT4-fs (sda1): mounted filesystem 8515de1c-ba7e-467b-adde-6d9f8a8dbc1f ro with ordered data mode. Quota mode: none. Jun 30 23:42:55 np0000004054 kernel: Cgroup memory moving (move_charge_at_immigrate) is deprecated. Please report your usecase to linux-mm@kvack.org if you depend on this functionality. Jun 30 23:42:55 np0000004054 kernel: Key type psk registered Jun 30 23:42:55 np0000004054 kernel: EXT4-fs (sda1): re-mounted 8515de1c-ba7e-467b-adde-6d9f8a8dbc1f r/w. Jun 30 23:42:55 np0000004054 kernel: storpool_rdma: loading out-of-tree module taints kernel. Jun 30 23:42:55 np0000004054 kernel: storpool_rdma: module verification failed: signature and/or required key missing - tainting kernel Jun 30 23:42:55 np0000004054 kernel: storpool_rdma: timeInit: tscPerUsec: 2395 Jun 30 23:42:55 np0000004054 kernel: virtio_net virtio8 sp0: renamed from enp10s0 Jun 30 23:42:55 np0000004054 kernel: virtio_net virtio7 sp-api: renamed from enp9s0 Jun 30 23:42:55 np0000004054 kernel: virtio_net virtio5 iscsi0: renamed from enp7s0 Jun 30 23:42:55 np0000004054 kernel: virtio_net virtio6 iscsi1: renamed from enp8s0 Jun 30 23:42:55 np0000004054 kernel: virtio_net virtio9 sp1: renamed from enp11s0 Jun 30 23:42:55 np0000004054 kernel: kvm_amd: TSC scaling supported Jun 30 23:42:55 np0000004054 kernel: kvm_amd: Nested Virtualization enabled Jun 30 23:42:55 np0000004054 kernel: kvm_amd: Nested Paging enabled Jun 30 23:42:55 np0000004054 kernel: kvm_amd: LBR virtualization supported Jun 30 23:42:55 np0000004054 kernel: kvm_amd: Virtual VMLOAD VMSAVE supported Jun 30 23:42:55 np0000004054 kernel: kvm_amd: Virtual GIF supported Jun 30 23:42:55 np0000004054 kernel: EXT4-fs (sda16): mounted filesystem 7dc15ce9-d090-44d7-bb05-2a36d545a8e3 r/w with ordered data mode. Quota mode: none. Jun 30 23:42:55 np0000004054 kernel: audit: type=1400 audit(1782862975.667:2): apparmor="STATUS" operation="profile_load" profile="unconfined" name="buildah" pid=1088 comm="apparmor_parser" Jun 30 23:42:55 np0000004054 kernel: audit: type=1400 audit(1782862975.667:3): apparmor="STATUS" operation="profile_load" profile="unconfined" name="balena-etcher" pid=1086 comm="apparmor_parser" Jun 30 23:42:55 np0000004054 kernel: audit: type=1400 audit(1782862975.668:4): apparmor="STATUS" operation="profile_load" profile="unconfined" name="1password" pid=1081 comm="apparmor_parser" Jun 30 23:42:55 np0000004054 kernel: audit: type=1400 audit(1782862975.668:5): apparmor="STATUS" operation="profile_load" profile="unconfined" name="ch-run" pid=1092 comm="apparmor_parser" Jun 30 23:42:55 np0000004054 kernel: audit: type=1400 audit(1782862975.668:6): apparmor="STATUS" operation="profile_load" profile="unconfined" name="QtWebEngineProcess" pid=1084 comm="apparmor_parser" Jun 30 23:42:55 np0000004054 kernel: audit: type=1400 audit(1782862975.668:7): apparmor="STATUS" operation="profile_load" profile="unconfined" name="brave" pid=1087 comm="apparmor_parser" Jun 30 23:42:55 np0000004054 kernel: audit: type=1400 audit(1782862975.668:8): apparmor="STATUS" operation="profile_load" profile="unconfined" name="cam" pid=1090 comm="apparmor_parser" Jun 30 23:42:55 np0000004054 kernel: audit: type=1400 audit(1782862975.668:9): apparmor="STATUS" operation="profile_load" profile="unconfined" name="Discord" pid=1082 comm="apparmor_parser" Jun 30 23:42:55 np0000004054 kernel: audit: type=1400 audit(1782862975.668:10): apparmor="STATUS" operation="profile_load" profile="unconfined" name="busybox" pid=1089 comm="apparmor_parser" Jun 30 23:43:00 np0000004054 kernel: kauditd_printk_skb: 112 callbacks suppressed Jun 30 23:43:00 np0000004054 kernel: audit: type=1400 audit(1782862980.578:123): apparmor="STATUS" operation="profile_replace" info="same as current profile, skipping" profile="unconfined" name="rsyslogd" pid=4971 comm="apparmor_parser" Jun 30 23:43:00 np0000004054 kernel: loop0: detected capacity change from 0 to 8 Jun 30 23:43:00 np0000004054 kernel: audit: type=1400 audit(1782862980.785:124): apparmor="STATUS" operation="profile_replace" profile="unconfined" name="/usr/lib/snapd/snap-confine" pid=5140 comm="apparmor_parser" Jun 30 23:43:00 np0000004054 kernel: audit: type=1400 audit(1782862980.794:125): apparmor="STATUS" operation="profile_replace" profile="unconfined" name="/usr/lib/snapd/snap-confine//mount-namespace-capture-helper" pid=5140 comm="apparmor_parser" Jun 30 23:43:46 np0000004054 sudo[5348]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-qklotgpognrzdjiybnzarikqcrvmwpus ; cat /proc/sys/kernel/random/boot_id' Jun 30 23:43:46 np0000004054 sudo[5348]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:43:46 np0000004054 sudo[5348]: pam_unix(sudo:session): session closed for user root Jun 30 23:43:46 np0000004054 sudo[5353]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-pygjxapwrfgworcvihehygkkofxzbcwc ; whoami' Jun 30 23:43:46 np0000004054 sudo[5353]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:43:46 np0000004054 sudo[5353]: pam_unix(sudo:session): session closed for user root Jun 30 23:43:53 np0000004054 sudo[6171]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-ubqwokzeqedshgzntqgxzkuemkzwxgzf ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782863033.1137366-10757-211731920574201/AnsiballZ_ufw.py' Jun 30 23:43:53 np0000004054 sudo[6171]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:43:53 np0000004054 sudo[6171]: pam_unix(sudo:session): session closed for user root Jun 30 23:43:54 np0000004054 sudo[6215]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-nvourhrpgfsulcflbzjwqhcaknspcxcc ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782863033.9432166-10757-50095381595780/AnsiballZ_ufw.py' Jun 30 23:43:54 np0000004054 sudo[6215]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:43:54 np0000004054 sudo[6215]: pam_unix(sudo:session): session closed for user root Jun 30 23:43:54 np0000004054 sudo[6254]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-brtgchfczrpmpeuoyplcxjprepcduhez ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782863034.5550876-10757-134967433441737/AnsiballZ_ufw.py' Jun 30 23:43:54 np0000004054 sudo[6254]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:43:55 np0000004054 sudo[6254]: pam_unix(sudo:session): session closed for user root Jun 30 23:43:55 np0000004054 sudo[6373]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-krfutvlnpywxaeqzxbkfthiudjonuzvb ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782863035.8888023-10787-253111287364758/AnsiballZ_command.py' Jun 30 23:43:55 np0000004054 sudo[6373]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:43:56 np0000004054 sudo[6373]: pam_unix(sudo:session): session closed for user root Jun 30 23:43:56 np0000004054 sudo[6396]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-iezzggzxjmrdkrjvaiipurfoqqtdaibl ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782863036.6807897-10800-127192826282002/AnsiballZ_command.py' Jun 30 23:43:56 np0000004054 sudo[6396]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:43:57 np0000004054 sudo[6396]: pam_unix(sudo:session): session closed for user root Jun 30 23:43:57 np0000004054 sudo[6428]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-yliyrrtbprwvipxppjlhnbfxlfzqavys ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782863037.5831134-10809-28407026896906/AnsiballZ_service_facts.py' Jun 30 23:43:57 np0000004054 sudo[6428]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:44:01 np0000004054 sudo[6428]: pam_unix(sudo:session): session closed for user root Jun 30 23:44:01 np0000004054 sudo[7032]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-ilctiesomjpdzbeyghgbrbrbdioaagsj ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782863041.853818-10827-266616515186335/AnsiballZ_file.py' Jun 30 23:44:01 np0000004054 sudo[7032]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:44:02 np0000004054 sudo[7032]: pam_unix(sudo:session): session closed for user root Jun 30 23:44:02 np0000004054 sudo[7050]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-yrlamvkyywdjqwogqguwfgngxsgqnnok ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782863042.2184267-10835-244642317967633/AnsiballZ_systemd.py' Jun 30 23:44:02 np0000004054 sudo[7050]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:44:02 np0000004054 sudo[7050]: pam_unix(sudo:session): session closed for user root Jun 30 23:44:02 np0000004054 sudo[7069]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-zvjopstvgtlujbtfxafrcmkujqdsadnc ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782863042.7652652-10844-211812321856365/AnsiballZ_command.py' Jun 30 23:44:02 np0000004054 sudo[7069]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:44:03 np0000004054 sudo[7069]: pam_unix(sudo:session): session closed for user root Jun 30 23:44:03 np0000004054 sudo[7092]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-ewaqxagtrnignjbkybvquxtouyrsiowm ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782863043.3423378-10853-142205460619355/AnsiballZ_stat.py' Jun 30 23:44:03 np0000004054 sudo[7092]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:44:03 np0000004054 sudo[7092]: pam_unix(sudo:session): session closed for user root Jun 30 23:44:03 np0000004054 sudo[7103]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-ekwejubhmfkplnelfviagpxvsxpnovdr ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782863043.3423378-10853-142205460619355/AnsiballZ_copy.py' Jun 30 23:44:03 np0000004054 sudo[7103]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:44:03 np0000004054 sudo[7103]: pam_unix(sudo:session): session closed for user root Jun 30 23:44:04 np0000004054 sudo[7121]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-jpnpotzhswbemzuzjprbekytvlbytuae ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782863043.980733-10868-103385886721020/AnsiballZ_copy.py' Jun 30 23:44:04 np0000004054 sudo[7121]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:44:04 np0000004054 sudo[7121]: pam_unix(sudo:session): session closed for user root Jun 30 23:44:05 np0000004054 sudo[7162]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-iumudvfabhdicoazhidbhxpyfxsqnwom ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782863044.953488-10891-126643674499735/AnsiballZ_slurp.py' Jun 30 23:44:05 np0000004054 sudo[7162]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:44:05 np0000004054 sudo[7162]: pam_unix(sudo:session): session closed for user root Jun 30 23:44:05 np0000004054 sudo[7180]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-ghbzsayseklmkyzpiebfnxmtthatdzpa ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782863045.580082-10902-186259717866811/AnsiballZ_command.py' Jun 30 23:44:05 np0000004054 sudo[7180]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:44:06 np0000004054 kernel: sdb: sdb1 Jun 30 23:44:09 np0000004054 sudo[7180]: pam_unix(sudo:session): session closed for user root Jun 30 23:44:09 np0000004054 sudo[7250]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-kzzdnuhifmpoiixgopdjnlxgfuveavhp ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782863049.344625-10910-35956993506247/AnsiballZ_systemd.py' Jun 30 23:44:09 np0000004054 sudo[7250]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:44:09 np0000004054 sudo[7250]: pam_unix(sudo:session): session closed for user root Jun 30 23:44:10 np0000004054 sudo[7284]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-cazznavufvfqvrvywbjiuaxzhcytehao ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782863049.951193-10919-99579165447189/AnsiballZ_stat.py' Jun 30 23:44:10 np0000004054 sudo[7284]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:44:10 np0000004054 sudo[7284]: pam_unix(sudo:session): session closed for user root Jun 30 23:44:10 np0000004054 sudo[7295]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-qlyndfbtzikkioyuxnkjmocrrwoscekr ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782863049.951193-10919-99579165447189/AnsiballZ_copy.py' Jun 30 23:44:10 np0000004054 sudo[7295]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:44:10 np0000004054 sudo[7295]: pam_unix(sudo:session): session closed for user root Jun 30 23:44:10 np0000004054 sudo[7313]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-jivaxirwfaljdlhzrznxsnewkdklaaxd ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782863050.6517189-10936-262241855156564/AnsiballZ_stat.py' Jun 30 23:44:10 np0000004054 sudo[7313]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:44:10 np0000004054 sudo[7313]: pam_unix(sudo:session): session closed for user root Jun 30 23:44:11 np0000004054 sudo[7348]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-gdrcgoytnpiypueuwzqrltvvbobhdxxy ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782863051.4469464-10954-224742600292196/AnsiballZ_command.py' Jun 30 23:44:11 np0000004054 sudo[7348]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:44:11 np0000004054 sudo[7348]: pam_unix(sudo:session): session closed for user root Jun 30 23:44:12 np0000004054 sudo[7371]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-paopnyhegqhfyrtmxacyiseegtepzgkq ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782863051.963682-10965-186694045534995/AnsiballZ_command.py' Jun 30 23:44:12 np0000004054 sudo[7371]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:44:15 np0000004054 sudo[7371]: pam_unix(sudo:session): session closed for user root Jun 30 23:44:15 np0000004054 sudo[7393]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-tuneiixircpgdystvttinusdruxzttal ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782863055.5690472-10974-141060359681608/AnsiballZ_systemd.py' Jun 30 23:44:15 np0000004054 sudo[7393]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:44:16 np0000004054 sudo[7393]: pam_unix(sudo:session): session closed for user root Jun 30 23:44:16 np0000004054 sudo[7413]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-vpttzsrgkhtkxnzoruiwdqkqumkmwtlv ; CGCONFIG_FORCE_STARTUP=1 /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782863056.1104953-10983-14769547181957/AnsiballZ_command.py' Jun 30 23:44:16 np0000004054 sudo[7413]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:44:16 np0000004054 sudo[7413]: pam_unix(sudo:session): session closed for user root Jun 30 23:44:18 np0000004054 sudo[7639]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-uphtihgtegyqfnqeirpwkeygpbszvaxi ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782863058.7455933-11019-189373452004002/AnsiballZ_command.py' Jun 30 23:44:18 np0000004054 sudo[7639]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:44:19 np0000004054 sudo[7639]: pam_unix(sudo:session): session closed for user root Jun 30 23:44:19 np0000004054 sudo[7661]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-byosbajhuwdsbvukauocpgxcmigieztc ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782863059.3526382-11027-70258608632617/AnsiballZ_command.py' Jun 30 23:44:19 np0000004054 sudo[7661]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:44:20 np0000004054 sudo[7661]: pam_unix(sudo:session): session closed for user root Jun 30 23:44:20 np0000004054 sudo[7813]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-jfetogqcbtseikbfwdcdepsjgacdiazf ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1782863060.6737595-11035-16118693575960/AnsiballZ_command.py' Jun 30 23:44:20 np0000004054 sudo[7813]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:44:22 np0000004054 kernel: storpool_bd: timeInit: tscPerUsec: 2395 Jun 30 23:44:22 np0000004054 kernel: storpool_pci 0000:07:00.0: probing Jun 30 23:44:22 np0000004054 kernel: storpool_pci 0000:07:00.0: device registered, physDev 0000:07:00.0 Jun 30 23:44:22 np0000004054 kernel: storpool_pci 0000:08:00.0: probing Jun 30 23:44:22 np0000004054 kernel: storpool_pci 0000:08:00.0: device registered, physDev 0000:08:00.0 Jun 30 23:44:23 np0000004054 sudo[7813]: pam_unix(sudo:session): session closed for user root Jun 30 23:44:23 np0000004054 kernel: block sdb: the capability attribute has been deprecated. Jun 30 23:44:23 np0000004054 kernel: storpool_disk: closeDisk: service 8085: disk sda closed Jun 30 23:44:24 np0000004054 sudo[8475]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-ypfyedswosokhmpgjwdbgdjgmxrzbexg ; /usr/bin/python3' Jun 30 23:44:24 np0000004054 sudo[8475]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:44:25 np0000004054 sudo[8475]: pam_unix(sudo:session): session closed for user root Jun 30 23:44:26 np0000004054 sudo[8551]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-wkjuwnzlbgynpmadlpahhqsimujjazev ; /usr/bin/python3' Jun 30 23:44:26 np0000004054 sudo[8551]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:44:26 np0000004054 sudo[8551]: pam_unix(sudo:session): session closed for user root Jun 30 23:44:27 np0000004054 kernel: virtio_net virtio7 sp-api: entered promiscuous mode Jun 30 23:44:27 np0000004054 kernel: virtio_net virtio7 sp-api: left promiscuous mode Jun 30 23:44:27 np0000004054 kernel: virtio_net virtio7 sp-api: entered promiscuous mode Jun 30 23:44:27 np0000004054 kernel: virtio_net virtio7 sp-api: left promiscuous mode Jun 30 23:44:27 np0000004054 kernel: virtio_net virtio7 sp-api: entered promiscuous mode Jun 30 23:44:27 np0000004054 kernel: virtio_net virtio7 sp-api: left promiscuous mode Jun 30 23:44:27 np0000004054 kernel: virtio_net virtio7 sp-api: entered promiscuous mode Jun 30 23:44:27 np0000004054 kernel: virtio_net virtio7 sp-api: left promiscuous mode Jun 30 23:44:27 np0000004054 kernel: virtio_net virtio7 sp-api: entered promiscuous mode Jun 30 23:44:27 np0000004054 kernel: virtio_net virtio7 sp-api: left promiscuous mode Jun 30 23:44:27 np0000004054 kernel: virtio_net virtio7 sp-api: entered promiscuous mode Jun 30 23:44:27 np0000004054 kernel: virtio_net virtio7 sp-api: left promiscuous mode Jun 30 23:44:27 np0000004054 sudo[8577]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-vyprpzhhyitshkduhqpobybkpzhmxugb ; /usr/bin/python3' Jun 30 23:44:27 np0000004054 sudo[8577]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:44:27 np0000004054 sudo[8577]: pam_unix(sudo:session): session closed for user root Jun 30 23:44:28 np0000004054 sudo[8592]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-zlkundjlfvmxspqoargcfqkpnifjdich ; /usr/bin/python3' Jun 30 23:44:28 np0000004054 sudo[8592]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:44:28 np0000004054 sudo[8592]: pam_unix(sudo:session): session closed for user root Jun 30 23:44:28 np0000004054 sudo[8611]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-qhnqghvppkkapmxeoiulhyxptfztzrqt ; /usr/bin/python3' Jun 30 23:44:28 np0000004054 sudo[8611]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:44:28 np0000004054 sudo[8611]: pam_unix(sudo:session): session closed for user root Jun 30 23:44:28 np0000004054 sudo[8636]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-rwlipdszfrtpvsbjqcjmvlnrmadyyaar ; /usr/bin/python3' Jun 30 23:44:28 np0000004054 sudo[8636]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:44:29 np0000004054 sudo[8636]: pam_unix(sudo:session): session closed for user root Jun 30 23:44:29 np0000004054 sudo[8649]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-tgohugdrlinsnlcsdwpetduwvmzzxzph ; /usr/bin/python3' Jun 30 23:44:29 np0000004054 sudo[8649]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:44:29 np0000004054 sudo[8649]: pam_unix(sudo:session): session closed for user root Jun 30 23:44:29 np0000004054 sudo[8662]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-gxogxzwfxdkanjieotgiepuyetpunhtw ; /usr/bin/python3' Jun 30 23:44:29 np0000004054 sudo[8662]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:44:29 np0000004054 sudo[8662]: pam_unix(sudo:session): session closed for user root Jun 30 23:44:29 np0000004054 sudo[8688]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-hkkvpgnpzscpclsofdqpfatsjxgnbpgb ; /usr/bin/python3' Jun 30 23:44:29 np0000004054 sudo[8688]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:44:30 np0000004054 sudo[8688]: pam_unix(sudo:session): session closed for user root Jun 30 23:44:30 np0000004054 sudo[8699]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-jauiwkfutwrjwqzwsdesqsbwyjmcofeu ; /usr/bin/python3' Jun 30 23:44:30 np0000004054 sudo[8699]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:44:30 np0000004054 sudo[8699]: pam_unix(sudo:session): session closed for user root Jun 30 23:44:30 np0000004054 sudo[8712]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-ejgubpxmbuiiqvbntnnpzfjaufuupnqk ; /usr/bin/python3' Jun 30 23:44:30 np0000004054 sudo[8712]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:44:31 np0000004054 sudo[8712]: pam_unix(sudo:session): session closed for user root Jun 30 23:44:31 np0000004054 sudo[8742]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-qwpmuetmszpnbvvqddunrgzksuvysrje ; /usr/bin/python3' Jun 30 23:44:31 np0000004054 sudo[8742]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jun 30 23:44:31 np0000004054 sudo[8742]: pam_unix(sudo:session): session closed for user root Jul 01 00:24:10 np0000004054 kernel: storpool_rdma: netdevNotifier: our interface sp0 is going down! Jul 01 00:24:10 np0000004054 kernel: storpool_rdma: netdevNotifier: our interface sp0 is going down! Jul 01 00:24:12 np0000004054 kernel: storpool_rdma: netdevNotifier: our interface sp1 is going down! Jul 01 00:24:12 np0000004054 kernel: storpool_rdma: netdevNotifier: our interface sp1 is going down! Jul 01 00:24:35 np0000004054 kernel: sd 0:0:0:1: [sdb] Synchronizing SCSI cache Jul 01 00:24:35 np0000004054 kernel: sd 0:0:0:1: LUN assignments on this target have changed. The Linux SCSI layer does not automatically remap LUN assignments. Jul 01 00:24:35 np0000004054 kernel: sd 0:0:0:1: [sdb] Synchronize Cache(10) failed: Result: hostbyte=DID_OK driverbyte=DRIVER_OK Jul 01 00:24:35 np0000004054 kernel: sd 0:0:0:1: [sdb] Sense Key : Illegal Request [current] Jul 01 00:24:35 np0000004054 kernel: sd 0:0:0:1: [sdb] Add. Sense: Logical unit not supported Jul 01 00:25:16 np0000004054 sudo[19086]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-bbdqnoyottriidbcorvpudccbacbtrqx ; /usr/bin/python3' Jul 01 00:25:16 np0000004054 sudo[19086]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 01 00:25:16 np0000004054 sudo[19086]: pam_unix(sudo:session): session closed for user root Jul 01 00:25:16 np0000004054 sudo[19094]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-jmrltbfjooruhkgbtzlmeqdnzzndhvxp ; /usr/bin/python3' Jul 01 00:25:16 np0000004054 sudo[19094]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 01 00:25:17 np0000004054 sudo[19094]: pam_unix(sudo:session): session closed for user root Jul 01 00:26:19 np0000004054 sudo[19367]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-ljfrvjjtbivedxzhakapeuxcvdspqrsb ; /usr/bin/python3' Jul 01 00:26:19 np0000004054 sudo[19367]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)