Aug 24 19:37:17 np0000008011 sudo[2306]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-oqeyiznbxnbaonzenrdpwuqzcgqcvlom ; /usr/bin/python3' Aug 24 19:37:17 np0000008011 sudo[2306]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:37:17 np0000008011 sudo[2306]: pam_unix(sudo:session): session closed for user root Aug 24 19:37:17 np0000008011 sudo[2324]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-plcychvivkdgcvvorfoaqbvuisxlhaxa ; /usr/bin/python3' Aug 24 19:37:17 np0000008011 sudo[2324]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:37:18 np0000008011 sudo[2324]: pam_unix(sudo:session): session closed for user root Aug 24 19:37:18 np0000008011 sudo[2333]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-yhbyywnofugxmaurkkhthsdrofowuchq ; /usr/bin/python3' Aug 24 19:37:18 np0000008011 sudo[2333]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:37:18 np0000008011 sudo[2333]: pam_unix(sudo:session): session closed for user root Aug 24 19:37:22 np0000008011 sudo[2347]: ubuntu : PWD=/home/ubuntu ; USER=stack ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-hykriezrfalelvmoqfupzjndiwfngpbb ; /usr/bin/python3' Aug 24 19:37:22 np0000008011 sudo[2347]: pam_unix(sudo:session): session opened for user stack(uid=1002) by ubuntu(uid=1000) Aug 24 19:37:22 np0000008011 sudo[2347]: pam_unix(sudo:session): session closed for user stack Aug 24 19:37:23 np0000008011 sudo[2402]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-odzgzgdfxkpmuandqgmfgxenxrtiikjb ; /usr/bin/python3' Aug 24 19:37:23 np0000008011 sudo[2402]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:37:24 np0000008011 sudo[2402]: pam_unix(sudo:session): session closed for user root Aug 24 19:37:24 np0000008011 sudo[2407]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-bdoicejblngmcecbubvbxeuisgtfltxx ; /usr/bin/python3' Aug 24 19:37:24 np0000008011 sudo[2407]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:37:24 np0000008011 sudo[2407]: pam_unix(sudo:session): session closed for user root Aug 24 19:37:24 np0000008011 sudo[2412]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-nlzahfrhibtmmkcmgucwrxizbjhsnmud ; /usr/bin/python3' Aug 24 19:37:24 np0000008011 sudo[2412]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:37:25 np0000008011 sudo[2412]: pam_unix(sudo:session): session closed for user root Aug 24 19:37:25 np0000008011 sudo[2550]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-qxxmfewufccisdgzbhiddotrvrpxuthv ; /usr/bin/python3' Aug 24 19:37:25 np0000008011 sudo[2550]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:37:26 np0000008011 sudo[2550]: pam_unix(sudo:session): session closed for user root Aug 24 19:37:26 np0000008011 sudo[2598]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-btmnqutryidrnrckpiovjexyhquuqnir ; /usr/bin/python3' Aug 24 19:37:26 np0000008011 sudo[2598]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:37:26 np0000008011 sudo[2598]: pam_unix(sudo:session): session closed for user root Aug 24 19:37:26 np0000008011 sudo[2647]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-lnqkamahyknzvkwjehnjfipkwjtxzlat ; /usr/bin/python3' Aug 24 19:37:26 np0000008011 sudo[2647]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:37:26 np0000008011 sudo[2647]: pam_unix(sudo:session): session closed for user root Aug 24 19:37:26 np0000008011 sudo[2694]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-olehjagusyqcvgfuoneczqtpnirumjvu ; /usr/bin/python3' Aug 24 19:37:26 np0000008011 sudo[2694]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:37:27 np0000008011 sudo[2694]: pam_unix(sudo:session): session closed for user root Aug 24 19:37:28 np0000008011 sudo[2742]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-hlantwbzpohtntjyossyoukiybvcztll ; /usr/bin/python3' Aug 24 19:37:28 np0000008011 sudo[2742]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:37:28 np0000008011 sudo[2742]: pam_unix(sudo:session): session closed for user root Aug 24 19:37:30 np0000008011 sudo[2810]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-piuwzdcpbrhygbugdrcmjjjohbjhdlzk ; /usr/bin/python3' Aug 24 19:37:30 np0000008011 sudo[2810]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:37:57 np0000008011 sudo[2810]: pam_unix(sudo:session): session closed for user root Aug 24 19:38:05 np0000008011 sudo[7891]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-oavoeiwpaxvozkqwxhsgccgfkbdkakgt ; /usr/bin/python3' Aug 24 19:38:05 np0000008011 sudo[7891]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:38:05 np0000008011 sudo[7891]: pam_unix(sudo:session): session closed for user root Aug 24 19:38:06 np0000008011 sudo[7899]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-fixedgpqavxpxhsggjugqaoahpphnabx ; /usr/bin/python3' Aug 24 19:38:06 np0000008011 sudo[7899]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:38:06 np0000008011 sudo[7899]: pam_unix(sudo:session): session closed for user root Aug 24 19:39:21 np0000008011 kernel: pci 0000:07:00.0: [1af4:1041] type 00 class 0x020000 PCIe Endpoint Aug 24 19:39:21 np0000008011 kernel: pci 0000:07:00.0: BAR 1 [mem 0x00000000-0x00000fff] Aug 24 19:39:21 np0000008011 kernel: pci 0000:07:00.0: BAR 4 [mem 0x00000000-0x00003fff 64bit pref] Aug 24 19:39:21 np0000008011 kernel: pci 0000:07:00.0: ROM [mem 0x00000000-0x0007ffff pref] Aug 24 19:39:21 np0000008011 kernel: pci 0000:07:00.0: ROM [mem 0xfe000000-0xfe07ffff pref]: assigned Aug 24 19:39:21 np0000008011 kernel: pci 0000:07:00.0: BAR 4 [mem 0xc160000000-0xc160003fff 64bit pref]: assigned Aug 24 19:39:21 np0000008011 kernel: pci 0000:07:00.0: BAR 1 [mem 0xfe080000-0xfe080fff]: assigned Aug 24 19:39:21 np0000008011 kernel: virtio-pci 0000:07:00.0: enabling device (0000 -> 0002) Aug 24 19:39:21 np0000008011 kernel: virtio_net virtio5 enp7s0: renamed from eth0 Aug 24 19:39:32 np0000008011 kernel: pci 0000:08:00.0: [1af4:1041] type 00 class 0x020000 PCIe Endpoint Aug 24 19:39:32 np0000008011 kernel: pci 0000:08:00.0: BAR 1 [mem 0x00000000-0x00000fff] Aug 24 19:39:32 np0000008011 kernel: pci 0000:08:00.0: BAR 4 [mem 0x00000000-0x00003fff 64bit pref] Aug 24 19:39:32 np0000008011 kernel: pci 0000:08:00.0: ROM [mem 0x00000000-0x0007ffff pref] Aug 24 19:39:32 np0000008011 kernel: pci 0000:08:00.0: ROM [mem 0xfde00000-0xfde7ffff pref]: assigned Aug 24 19:39:32 np0000008011 kernel: pci 0000:08:00.0: BAR 4 [mem 0xc140000000-0xc140003fff 64bit pref]: assigned Aug 24 19:39:32 np0000008011 kernel: pci 0000:08:00.0: BAR 1 [mem 0xfde80000-0xfde80fff]: assigned Aug 24 19:39:32 np0000008011 kernel: virtio-pci 0000:08:00.0: enabling device (0000 -> 0002) Aug 24 19:39:32 np0000008011 kernel: virtio_net virtio6 enp8s0: renamed from eth0 Aug 24 19:40:10 np0000008011 sudo[7987]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-vywezlcsqcavfxbjlkyrccvooefzyved ; /usr/bin/python3' Aug 24 19:40:10 np0000008011 sudo[7987]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:40:10 np0000008011 sudo[7987]: pam_unix(sudo:session): session closed for user root Aug 24 19:40:10 np0000008011 sudo[7996]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-kkxmxwytfxrcojshdmxklglojyhwmzmk ; /usr/bin/python3' Aug 24 19:40:10 np0000008011 sudo[7996]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:40:11 np0000008011 sudo[7996]: pam_unix(sudo:session): session closed for user root Aug 24 19:40:11 np0000008011 sudo[8005]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-yxexozacygxgzwunctpqbpunlticypps ; /usr/bin/python3' Aug 24 19:40:11 np0000008011 sudo[8005]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:40:12 np0000008011 sudo[8005]: pam_unix(sudo:session): session closed for user root Aug 24 19:40:12 np0000008011 sudo[8060]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-vjfxcqplovxvkmcuziibedryiqxgrchd ; /usr/bin/python3' Aug 24 19:40:12 np0000008011 sudo[8060]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:40:13 np0000008011 kernel: virtio_net virtio5 iscsi0: renamed from enp7s0 Aug 24 19:40:13 np0000008011 kernel: virtio_net virtio6 iscsi1: renamed from enp8s0 Aug 24 19:40:13 np0000008011 kernel: 8021q: adding VLAN 0 to HW filter on device iscsi0 Aug 24 19:40:13 np0000008011 kernel: 8021q: adding VLAN 0 to HW filter on device iscsi1 Aug 24 19:40:13 np0000008011 sudo[8060]: pam_unix(sudo:session): session closed for user root Aug 24 19:40:52 np0000008011 kernel: pci 0000:09:00.0: [1af4:1041] type 00 class 0x020000 PCIe Endpoint Aug 24 19:40:52 np0000008011 kernel: pci 0000:09:00.0: BAR 1 [mem 0x00000000-0x00000fff] Aug 24 19:40:52 np0000008011 kernel: pci 0000:09:00.0: BAR 4 [mem 0x00000000-0x00003fff 64bit pref] Aug 24 19:40:52 np0000008011 kernel: pci 0000:09:00.0: ROM [mem 0x00000000-0x0007ffff pref] Aug 24 19:40:52 np0000008011 kernel: pci 0000:09:00.0: ROM [mem 0xfdc00000-0xfdc7ffff pref]: assigned Aug 24 19:40:52 np0000008011 kernel: pci 0000:09:00.0: BAR 4 [mem 0xc120000000-0xc120003fff 64bit pref]: assigned Aug 24 19:40:52 np0000008011 kernel: pci 0000:09:00.0: BAR 1 [mem 0xfdc80000-0xfdc80fff]: assigned Aug 24 19:40:52 np0000008011 kernel: virtio-pci 0000:09:00.0: enabling device (0000 -> 0002) Aug 24 19:40:52 np0000008011 kernel: virtio_net virtio7 enp9s0: renamed from eth0 Aug 24 19:41:04 np0000008011 kernel: pci 0000:0a:00.0: [1af4:1041] type 00 class 0x020000 PCIe Endpoint Aug 24 19:41:04 np0000008011 kernel: pci 0000:0a:00.0: BAR 1 [mem 0x00000000-0x00000fff] Aug 24 19:41:04 np0000008011 kernel: pci 0000:0a:00.0: BAR 4 [mem 0x00000000-0x00003fff 64bit pref] Aug 24 19:41:04 np0000008011 kernel: pci 0000:0a:00.0: ROM [mem 0x00000000-0x0007ffff pref] Aug 24 19:41:04 np0000008011 kernel: pci 0000:0a:00.0: ROM [mem 0xfda00000-0xfda7ffff pref]: assigned Aug 24 19:41:04 np0000008011 kernel: pci 0000:0a:00.0: BAR 4 [mem 0xc100000000-0xc100003fff 64bit pref]: assigned Aug 24 19:41:04 np0000008011 kernel: pci 0000:0a:00.0: BAR 1 [mem 0xfda80000-0xfda80fff]: assigned Aug 24 19:41:04 np0000008011 kernel: virtio-pci 0000:0a:00.0: enabling device (0000 -> 0002) Aug 24 19:41:04 np0000008011 kernel: virtio_net virtio8 enp10s0: renamed from eth0 Aug 24 19:41:16 np0000008011 kernel: pci 0000:0b:00.0: [1af4:1041] type 00 class 0x020000 PCIe Endpoint Aug 24 19:41:16 np0000008011 kernel: pci 0000:0b:00.0: BAR 1 [mem 0x00000000-0x00000fff] Aug 24 19:41:16 np0000008011 kernel: pci 0000:0b:00.0: BAR 4 [mem 0x00000000-0x00003fff 64bit pref] Aug 24 19:41:16 np0000008011 kernel: pci 0000:0b:00.0: ROM [mem 0x00000000-0x0007ffff pref] Aug 24 19:41:16 np0000008011 kernel: pci 0000:0b:00.0: ROM [mem 0xfd800000-0xfd87ffff pref]: assigned Aug 24 19:41:16 np0000008011 kernel: pci 0000:0b:00.0: BAR 4 [mem 0xc0e0000000-0xc0e0003fff 64bit pref]: assigned Aug 24 19:41:16 np0000008011 kernel: pci 0000:0b:00.0: BAR 1 [mem 0xfd880000-0xfd880fff]: assigned Aug 24 19:41:16 np0000008011 kernel: virtio-pci 0000:0b:00.0: enabling device (0000 -> 0002) Aug 24 19:41:16 np0000008011 kernel: virtio_net virtio9 enp11s0: renamed from eth0 Aug 24 19:41:49 np0000008011 kernel: scsi 0:0:0:1: Direct-Access QEMU QEMU HARDDISK 2.5+ PQ: 0 ANSI: 5 Aug 24 19:41:49 np0000008011 kernel: sd 0:0:0:1: Power-on or device reset occurred Aug 24 19:41:49 np0000008011 kernel: sd 0:0:0:1: LUN assignments on this target have changed. The Linux SCSI layer does not automatically remap LUN assignments. Aug 24 19:41:49 np0000008011 kernel: sd 0:0:0:1: [sdb] 482344960 512-byte logical blocks: (247 GB/230 GiB) Aug 24 19:41:49 np0000008011 kernel: sd 0:0:0:1: [sdb] Write Protect is off Aug 24 19:41:49 np0000008011 kernel: sd 0:0:0:1: [sdb] Mode Sense: 63 00 00 08 Aug 24 19:41:49 np0000008011 kernel: sd 0:0:0:1: [sdb] Write cache: enabled, read cache: enabled, doesn't support DPO or FUA Aug 24 19:41:49 np0000008011 kernel: sd 0:0:0:1: [sdb] Attached SCSI disk Aug 24 19:41:49 np0000008011 kernel: sd 0:0:0:1: Attached scsi generic sg1 type 0 Aug 24 19:41:50 np0000008011 sudo[8265]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-rkykaxlfkbvdiadccswxmdarvzejwolr ; /usr/bin/python3' Aug 24 19:41:50 np0000008011 sudo[8265]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:41:50 np0000008011 sudo[8265]: pam_unix(sudo:session): session closed for user root Aug 24 19:41:50 np0000008011 sudo[8274]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-nxdzoohfxdxfehlcydrdyaakpjeacpve ; /usr/bin/python3' Aug 24 19:41:50 np0000008011 sudo[8274]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:41:50 np0000008011 sudo[8274]: pam_unix(sudo:session): session closed for user root Aug 24 19:41:51 np0000008011 sudo[8282]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-gikvsnvupsomrgjujxbidoehgpcdvpxc ; /usr/bin/python3' Aug 24 19:41:51 np0000008011 sudo[8282]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:41:51 np0000008011 sudo[8282]: pam_unix(sudo:session): session closed for user root Aug 24 19:41:52 np0000008011 sudo[8334]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-knidlfdntxgaqncichcfigebmbtlfowx ; /usr/bin/python3' Aug 24 19:41:52 np0000008011 sudo[8334]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:41:52 np0000008011 kernel: virtio_net virtio7 sp-api: renamed from enp9s0 Aug 24 19:41:52 np0000008011 kernel: virtio_net virtio8 sp0: renamed from enp10s0 Aug 24 19:41:52 np0000008011 kernel: virtio_net virtio9 sp1: renamed from enp11s0 Aug 24 19:41:52 np0000008011 kernel: 8021q: adding VLAN 0 to HW filter on device sp0 Aug 24 19:41:52 np0000008011 kernel: 8021q: adding VLAN 0 to HW filter on device sp-api Aug 24 19:41:52 np0000008011 kernel: 8021q: adding VLAN 0 to HW filter on device sp1 Aug 24 19:41:52 np0000008011 sudo[8334]: pam_unix(sudo:session): session closed for user root Aug 24 19:42:37 np0000008011 sudo[8585]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-rcwxmfbkhijzcvvtprchlbntunaogmiq ; cat /etc/os-release' Aug 24 19:42:37 np0000008011 sudo[8585]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:42:37 np0000008011 sudo[8585]: pam_unix(sudo:session): session closed for user root Aug 24 19:42:37 np0000008011 sudo[8589]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-njewmisxjkvgycjkwyqsvoomzczenrob ; apt-get update && env DEBIAN_FRONTEND=noninteractive apt-get install -y python3' Aug 24 19:42:37 np0000008011 sudo[8589]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:42:39 np0000008011 sudo[8589]: pam_unix(sudo:session): session closed for user root Aug 24 19:42:41 np0000008011 sudo[8975]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-witplyefegnbsktlavvsqvczaqsmhspp ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600560.81516-10002-12521635077371/AnsiballZ_apt.py' Aug 24 19:42:41 np0000008011 sudo[8975]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:42:42 np0000008011 sudo[8975]: pam_unix(sudo:session): session closed for user root Aug 24 19:42:42 np0000008011 sudo[9257]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-ijkulcgduazghcjayuamltwssfnmeldp ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600562.626373-10010-114677780232528/AnsiballZ_apt.py' Aug 24 19:42:42 np0000008011 sudo[9257]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:42:51 np0000008011 sudo[9257]: pam_unix(sudo:session): session closed for user root Aug 24 19:42:51 np0000008011 sudo[14839]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-zpoqwotglzwakkejmhfemaewozzpvxof ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600571.5572648-10020-245338614034981/AnsiballZ_get_url.py' Aug 24 19:42:51 np0000008011 sudo[14839]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:42:52 np0000008011 sudo[14839]: pam_unix(sudo:session): session closed for user root Aug 24 19:42:52 np0000008011 sudo[14857]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-lrpvnsnpadjbmjnkygncquhbcstskfgh ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600572.137423-10028-161814365342955/AnsiballZ_stat.py' Aug 24 19:42:52 np0000008011 sudo[14857]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:42:52 np0000008011 sudo[14857]: pam_unix(sudo:session): session closed for user root Aug 24 19:42:52 np0000008011 sudo[14868]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-zlvgjcizwtrozfvopclycywmvlnbigzr ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600572.137423-10028-161814365342955/AnsiballZ_copy.py' Aug 24 19:42:52 np0000008011 sudo[14868]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:42:52 np0000008011 sudo[14868]: pam_unix(sudo:session): session closed for user root Aug 24 19:42:53 np0000008011 sudo[14886]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-xvvhwnbtrchmnsodlokwcvgqkfcxtpln ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600572.9829764-10044-178858435344511/AnsiballZ_apt.py' Aug 24 19:42:53 np0000008011 sudo[14886]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:42:56 np0000008011 sudo[14886]: pam_unix(sudo:session): session closed for user root Aug 24 19:42:56 np0000008011 sudo[15211]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-ytvihhgwfytgaspkcpbtnmgaphikpqth ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600576.6103132-10054-159474311610651/AnsiballZ_apt.py' Aug 24 19:42:56 np0000008011 sudo[15211]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:43:05 np0000008011 sudo[15211]: pam_unix(sudo:session): session closed for user root Aug 24 19:43:06 np0000008011 sudo[15372]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-qoubcllwjuckzfxhgklvrhgotcudmqjr ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600586.4294646-10081-64161950721104/AnsiballZ_apt.py' Aug 24 19:43:06 np0000008011 sudo[15372]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:43:07 np0000008011 sudo[15372]: pam_unix(sudo:session): session closed for user root Aug 24 19:43:08 np0000008011 sudo[15690]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-zmuhpjndmzcswzpfonzeqeukfttgigie ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600588.0665352-10091-40469972232505/AnsiballZ_apt.py' Aug 24 19:43:08 np0000008011 sudo[15690]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:43:08 np0000008011 sudo[15690]: pam_unix(sudo:session): session closed for user root Aug 24 19:43:09 np0000008011 sudo[15714]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-qziqlgyjmfvclnonllnjiagylpfnagrl ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600589.096095-10101-187910373179855/AnsiballZ_apt.py' Aug 24 19:43:09 np0000008011 sudo[15714]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:43:23 np0000008011 kernel: Key type psk registered Aug 24 19:43:26 np0000008011 kernel: audit: type=1400 audit(1787600606.325:125): apparmor="STATUS" operation="profile_load" profile="unconfined" name="/usr/sbin/chronyd" pid=17318 comm="apparmor_parser" Aug 24 19:43:31 np0000008011 sudo[15714]: pam_unix(sudo:session): session closed for user root Aug 24 19:43:31 np0000008011 sudo[17582]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-ltbyixnmgnjbdeugizkvelxlwfthmubv ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600611.338942-10110-68724105915427/AnsiballZ_stat.py' Aug 24 19:43:31 np0000008011 sudo[17582]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:43:31 np0000008011 sudo[17582]: pam_unix(sudo:session): session closed for user root Aug 24 19:43:31 np0000008011 sudo[17593]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-ctpnkpexeibunyscsueyjlcyjkinjryr ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600611.338942-10110-68724105915427/AnsiballZ_copy.py' Aug 24 19:43:31 np0000008011 sudo[17593]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:43:31 np0000008011 sudo[17593]: pam_unix(sudo:session): session closed for user root Aug 24 19:43:32 np0000008011 sudo[17611]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-cvltabdlnlqnphhdlkmkunbgwszbnsbq ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600612.0087893-10125-69375741959925/AnsiballZ_mount.py' Aug 24 19:43:32 np0000008011 sudo[17611]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:43:32 np0000008011 sudo[17611]: pam_unix(sudo:session): session closed for user root Aug 24 19:43:32 np0000008011 sudo[17630]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-iylpmkufqyqtjtycmhcfhookqcgdxtvn ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600612.481428-10133-26727586701017/AnsiballZ_command.py' Aug 24 19:43:32 np0000008011 sudo[17630]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:43:32 np0000008011 sudo[17630]: pam_unix(sudo:session): session closed for user root Aug 24 19:43:33 np0000008011 sudo[17649]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-jynzpxtaauqiylaarkifguesgvubzaoc ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600613.0128367-10141-63874423559566/AnsiballZ_lineinfile.py' Aug 24 19:43:33 np0000008011 sudo[17649]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:43:33 np0000008011 sudo[17649]: pam_unix(sudo:session): session closed for user root Aug 24 19:43:34 np0000008011 sudo[17714]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-mkoavudajepvfoddrshghduavbogbbci ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600614.569592-10173-157328785758752/AnsiballZ_lineinfile.py' Aug 24 19:43:34 np0000008011 sudo[17714]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:43:34 np0000008011 sudo[17714]: pam_unix(sudo:session): session closed for user root Aug 24 19:43:38 np0000008011 sudo[18199]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-rqabjknnciloxkterxhjocsaxqrgolad ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600618.2427332-10189-106135564405353/AnsiballZ_systemd.py' Aug 24 19:43:38 np0000008011 sudo[18199]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:43:39 np0000008011 sudo[18199]: pam_unix(sudo:session): session closed for user root Aug 24 19:43:42 np0000008011 sudo[18236]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-duhymxgsohuatvxfjajgjevlgcitqfkz ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600622.1163938-10210-86458503758167/AnsiballZ_lineinfile.py' Aug 24 19:43:42 np0000008011 sudo[18236]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:43:42 np0000008011 sudo[18236]: pam_unix(sudo:session): session closed for user root Aug 24 19:43:42 np0000008011 sudo[18254]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-suztqaxmxsgjqrzvvxsgkxepcaaevrjb ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600622.4895468-10210-42785203511567/AnsiballZ_lineinfile.py' Aug 24 19:43:42 np0000008011 sudo[18254]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:43:42 np0000008011 sudo[18254]: pam_unix(sudo:session): session closed for user root Aug 24 19:43:43 np0000008011 sudo[18272]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-zqizmuwiqolpqxagwomtcvhbiqmsrmqn ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600622.9582744-10225-96973587656093/AnsiballZ_systemd.py' Aug 24 19:43:43 np0000008011 sudo[18272]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:43:43 np0000008011 sudo[18272]: pam_unix(sudo:session): session closed for user root Aug 24 19:43:43 np0000008011 sudo[18338]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-vpqdluektikdzmpejcllmzabgvkbdgng ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600623.7886274-10225-120247908433200/AnsiballZ_systemd.py' Aug 24 19:43:43 np0000008011 sudo[18338]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:43:44 np0000008011 sudo[18338]: pam_unix(sudo:session): session closed for user root Aug 24 19:43:44 np0000008011 sudo[18360]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-povhatvhecxqgsouoqvygoopbntbdiop ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600624.3801365-10240-18807141277886/AnsiballZ_lineinfile.py' Aug 24 19:43:44 np0000008011 sudo[18360]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:43:44 np0000008011 sudo[18360]: pam_unix(sudo:session): session closed for user root Aug 24 19:43:44 np0000008011 sudo[18378]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-ewzzperefaefmemiacmrjqybzzzumxds ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600624.759422-10248-25250377281402/AnsiballZ_systemd.py' Aug 24 19:43:44 np0000008011 sudo[18378]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:43:45 np0000008011 sudo[18378]: pam_unix(sudo:session): session closed for user root Aug 24 19:43:46 np0000008011 sudo[18547]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-tbejwpkrxmemsgstysarwtnokadonbea ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600626.7579522-10282-166026135954122/AnsiballZ_stat.py' Aug 24 19:43:46 np0000008011 sudo[18547]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:43:47 np0000008011 sudo[18547]: pam_unix(sudo:session): session closed for user root Aug 24 19:43:47 np0000008011 sudo[18558]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-ikzxudeghvxwcujgrijfchajjrtmyekv ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600626.7579522-10282-166026135954122/AnsiballZ_copy.py' Aug 24 19:43:47 np0000008011 sudo[18558]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:43:47 np0000008011 sudo[18558]: pam_unix(sudo:session): session closed for user root Aug 24 19:43:48 np0000008011 sudo[18591]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-ksdodvwygknlyajvpcthxufjckvfbziz ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600627.9127138-10305-68977838718707/AnsiballZ_file.py' Aug 24 19:43:48 np0000008011 sudo[18591]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:43:48 np0000008011 sudo[18591]: pam_unix(sudo:session): session closed for user root Aug 24 19:43:48 np0000008011 sudo[18609]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-sfvngxxtfprvpoyynyiqafzecqfsyhvt ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600628.3008144-10305-254084843174762/AnsiballZ_file.py' Aug 24 19:43:48 np0000008011 sudo[18609]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:43:48 np0000008011 sudo[18609]: pam_unix(sudo:session): session closed for user root Aug 24 19:43:48 np0000008011 sudo[18627]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-jnfunmmlieiktrjjgwkatjidaingaagh ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600628.6447778-10305-196715195194404/AnsiballZ_file.py' Aug 24 19:43:48 np0000008011 sudo[18627]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:43:48 np0000008011 sudo[18627]: pam_unix(sudo:session): session closed for user root Aug 24 19:43:49 np0000008011 sudo[18645]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-dpgixmxvilboyzbljmopnidqdawgaxve ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600628.9901571-10305-19678589945565/AnsiballZ_file.py' Aug 24 19:43:49 np0000008011 sudo[18645]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:43:49 np0000008011 sudo[18645]: pam_unix(sudo:session): session closed for user root Aug 24 19:43:49 np0000008011 sudo[18663]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-zqjrhqbraptumeacarzaxtrdizymturo ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600629.3313818-10305-162833037242435/AnsiballZ_file.py' Aug 24 19:43:49 np0000008011 sudo[18663]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:43:49 np0000008011 sudo[18663]: pam_unix(sudo:session): session closed for user root Aug 24 19:43:50 np0000008011 sudo[18681]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-xlviihjqxpnaufqwsenvyekyfroapmnx ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600629.9847107-10349-158360052914154/AnsiballZ_apt.py' Aug 24 19:43:50 np0000008011 sudo[18681]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:43:50 np0000008011 sudo[18681]: pam_unix(sudo:session): session closed for user root Aug 24 19:43:51 np0000008011 sudo[18705]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-tkprarejjkalvagunlukaenbaqavaasx ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600631.0159607-10357-37441978166512/AnsiballZ_apt.py' Aug 24 19:43:51 np0000008011 sudo[18705]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:43:51 np0000008011 sudo[18705]: pam_unix(sudo:session): session closed for user root Aug 24 19:43:53 np0000008011 sudo[18759]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-zjgxekhtjkokhqqssfhihzbxnqggymfl ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600633.2918806-10393-197437558403268/AnsiballZ_stat.py' Aug 24 19:43:53 np0000008011 sudo[18759]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:43:53 np0000008011 sudo[18759]: pam_unix(sudo:session): session closed for user root Aug 24 19:43:53 np0000008011 sudo[18770]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-gyqnbxvbwjoffmrfjbnjkktvpmoowbhz ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600633.2918806-10393-197437558403268/AnsiballZ_copy.py' Aug 24 19:43:53 np0000008011 sudo[18770]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:43:53 np0000008011 sudo[18770]: pam_unix(sudo:session): session closed for user root Aug 24 19:43:54 np0000008011 sudo[18788]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-msfujlhzmoylyqhwfsvysxpjbfirzkzv ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600633.9746416-10408-131912556406489/AnsiballZ_command.py' Aug 24 19:43:54 np0000008011 sudo[18788]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:43:55 np0000008011 sudo[18788]: pam_unix(sudo:session): session closed for user root Aug 24 19:43:55 np0000008011 sudo[18808]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-cfencuzksqhzsdaetuyqaceleiqdgtip ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600635.1238203-10417-58745266266473/AnsiballZ_file.py' Aug 24 19:43:55 np0000008011 sudo[18808]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:43:55 np0000008011 sudo[18808]: pam_unix(sudo:session): session closed for user root Aug 24 19:43:56 np0000008011 sudo[18827]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-ymvwovtvrggfylhlfctstegvlmzflcul ; ANSIBLE_ASYNC_DIR=\'~/.ansible_async\' /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600635.915895-10447-39780650345623/async_wrapper.py j703038979332 1000 false /home/ubuntu/.ansible/tmp/ansible-tmp-1787600635.915895-10447-39780650345623/AnsiballZ_command.py /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600635.915895-10447-39780650345623/AnsiballZ_command.py' Aug 24 19:43:56 np0000008011 sudo[18827]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:43:56 np0000008011 sudo[18827]: pam_unix(sudo:session): session closed for user root Aug 24 19:43:57 np0000008011 sudo[18976]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-yqintjawuqllkaodopksbfzmhkaoqzti ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600636.9286761-10473-176915580579315/AnsiballZ_async_status.py' Aug 24 19:43:57 np0000008011 sudo[18976]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:43:57 np0000008011 sudo[18976]: pam_unix(sudo:session): session closed for user root Aug 24 19:44:02 np0000008011 sudo[19518]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-omcdrybdzwhnctmsxuerascifkucbego ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600642.3672063-10473-184311999184252/AnsiballZ_async_status.py' Aug 24 19:44:02 np0000008011 sudo[19518]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:44:02 np0000008011 sudo[19518]: pam_unix(sudo:session): session closed for user root Aug 24 19:44:07 np0000008011 sudo[20066]: ubuntu : TTY=pts/1 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-cbirjkwvanreqsrsgjjtczeavykltkey ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600647.7320337-10473-269831921978490/AnsiballZ_async_status.py' Aug 24 19:44:07 np0000008011 sudo[20066]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:44:08 np0000008011 sudo[20066]: pam_unix(sudo:session): session closed for user root Aug 24 19:44:13 np0000008011 sudo[20097]: ubuntu : TTY=pts/1 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-piyhhldzchfrsfigpqfhgftitqnogkpy ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600653.0592055-10473-143095510512472/AnsiballZ_async_status.py' Aug 24 19:44:13 np0000008011 sudo[20097]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:44:13 np0000008011 sudo[20097]: pam_unix(sudo:session): session closed for user root Aug 24 19:44:18 np0000008011 sudo[20991]: ubuntu : TTY=pts/1 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-trvhrxifgwdvjhmqrtlpagkvriisjylt ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600658.413888-10473-241183947615119/AnsiballZ_async_status.py' Aug 24 19:44:18 np0000008011 sudo[20991]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:44:18 np0000008011 sudo[20991]: pam_unix(sudo:session): session closed for user root Aug 24 19:44:23 np0000008011 sudo[23186]: ubuntu : TTY=pts/1 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-uymzzjbzxvpfzmxpkjaticfispdvycce ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600663.742792-10473-1923600580003/AnsiballZ_async_status.py' Aug 24 19:44:23 np0000008011 sudo[23186]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:44:24 np0000008011 sudo[23186]: pam_unix(sudo:session): session closed for user root Aug 24 19:44:27 np0000008011 kernel: audit: type=1400 audit(1787600667.263:126): apparmor="STATUS" operation="profile_replace" info="same as current profile, skipping" profile="unconfined" name="rsyslogd" pid=25543 comm="apparmor_parser" Aug 24 19:44:29 np0000008011 sudo[25761]: ubuntu : TTY=pts/1 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-xyklrrvpvgiaugjmepjycvquplumimdk ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600669.072047-10473-223203145819720/AnsiballZ_async_status.py' Aug 24 19:44:29 np0000008011 sudo[25761]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:44:29 np0000008011 sudo[25761]: pam_unix(sudo:session): session closed for user root Aug 24 19:44:34 np0000008011 sudo[30628]: ubuntu : TTY=pts/1 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-fpgtsifzbigeezxfdagodqadiioacktx ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600674.4169364-10473-83777934928412/AnsiballZ_async_status.py' Aug 24 19:44:34 np0000008011 sudo[30628]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:44:34 np0000008011 sudo[30628]: pam_unix(sudo:session): session closed for user root Aug 24 19:44:39 np0000008011 sudo[33316]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-vbtcouttrjapwpdqcrencaahcvspgcew ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600679.748058-10473-65277062813704/AnsiballZ_async_status.py' Aug 24 19:44:39 np0000008011 sudo[33316]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:44:40 np0000008011 sudo[33316]: pam_unix(sudo:session): session closed for user root Aug 24 19:44:45 np0000008011 sudo[33577]: ubuntu : TTY=pts/1 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-loylcbmwsijkjqwcfehguyubjmpbuulw ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600685.0721643-10473-185697876506016/AnsiballZ_async_status.py' Aug 24 19:44:45 np0000008011 sudo[33577]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:44:45 np0000008011 sudo[33577]: pam_unix(sudo:session): session closed for user root Aug 24 19:44:49 np0000008011 kernel: audit: type=1400 audit(1787600689.788:127): apparmor="STATUS" operation="profile_replace" info="same as current profile, skipping" profile="unconfined" name="rsyslogd" pid=33798 comm="apparmor_parser" Aug 24 19:44:50 np0000008011 sudo[33819]: ubuntu : TTY=pts/1 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-icsjqyelpbqlozsmyrjbcfbebfyoqhfi ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600690.4366183-10473-193573765447968/AnsiballZ_async_status.py' Aug 24 19:44:50 np0000008011 sudo[33819]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:44:50 np0000008011 sudo[33819]: pam_unix(sudo:session): session closed for user root Aug 24 19:44:55 np0000008011 sudo[34028]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-jljckgiqqrqneoxclhbjkbavogkmrlem ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600695.7709794-10473-154973637228656/AnsiballZ_async_status.py' Aug 24 19:44:55 np0000008011 sudo[34028]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:44:56 np0000008011 kernel: audit: type=1400 audit(1787600696.006:128): apparmor="STATUS" operation="profile_replace" profile="unconfined" name="tcpdump" pid=34034 comm="apparmor_parser" Aug 24 19:44:56 np0000008011 sudo[34028]: pam_unix(sudo:session): session closed for user root Aug 24 19:45:01 np0000008011 sudo[37848]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-sirejfjsxmsnzzfuelbcdjxeykwgqrab ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600701.0882523-10473-190523359500843/AnsiballZ_async_status.py' Aug 24 19:45:01 np0000008011 sudo[37848]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:45:01 np0000008011 sudo[37848]: pam_unix(sudo:session): session closed for user root Aug 24 19:45:06 np0000008011 sudo[41917]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-piykikaidmhdamfvcxopddgptsqiyzxl ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600706.4156897-10473-270862557248001/AnsiballZ_async_status.py' Aug 24 19:45:06 np0000008011 sudo[41917]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:45:06 np0000008011 sudo[41917]: pam_unix(sudo:session): session closed for user root Aug 24 19:45:11 np0000008011 sudo[42289]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-dunhajmxkcmvhembiifvhafellsclsgb ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600711.735293-10473-144248888989673/AnsiballZ_async_status.py' Aug 24 19:45:11 np0000008011 sudo[42289]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:45:12 np0000008011 sudo[42289]: pam_unix(sudo:session): session closed for user root Aug 24 19:45:12 np0000008011 sudo[42307]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-pmrywmqryfafojayvqcxjshdgonkiexv ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600712.0801284-10597-62190378915155/AnsiballZ_systemd.py' Aug 24 19:45:12 np0000008011 sudo[42307]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:45:12 np0000008011 kernel: audit: type=1400 audit(1787600712.580:129): apparmor="STATUS" operation="profile_replace" info="same as current profile, skipping" profile="unconfined" name="rsyslogd" pid=42319 comm="apparmor_parser" Aug 24 19:45:12 np0000008011 sudo[42307]: pam_unix(sudo:session): session closed for user root Aug 24 19:45:12 np0000008011 sudo[42339]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-zknesdghngeydzhgrjpvnqppjvhbwhdp ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600712.713366-10605-9719295837929/AnsiballZ_command.py' Aug 24 19:45:12 np0000008011 sudo[42339]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:45:13 np0000008011 sudo[42339]: pam_unix(sudo:session): session closed for user root Aug 24 19:45:13 np0000008011 sudo[42361]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-meoobibdjhfppyjrrkzeduotglsypmxn ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600713.1164308-10615-260602089259748/AnsiballZ_command.py' Aug 24 19:45:13 np0000008011 sudo[42361]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:45:13 np0000008011 sudo[42361]: pam_unix(sudo:session): session closed for user root Aug 24 19:45:13 np0000008011 sudo[42380]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-tacqhglqmsvjfiuloizjbunpqdrqnbmk ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600713.5608225-10623-127766915100087/AnsiballZ_lineinfile.py' Aug 24 19:45:13 np0000008011 sudo[42380]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:45:13 np0000008011 sudo[42380]: pam_unix(sudo:session): session closed for user root Aug 24 19:45:14 np0000008011 sudo[42398]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-mqriiiwzopbjjtgvhcdvbgnlirdkctiz ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600714.0172744-10634-199711132786765/AnsiballZ_command.py' Aug 24 19:45:14 np0000008011 sudo[42398]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:45:14 np0000008011 sudo[42398]: pam_unix(sudo:session): session closed for user root Aug 24 19:45:14 np0000008011 sudo[42420]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-pabggjfocadtcklxerwvrawvvbiervph ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600714.4418106-10642-35994212293588/AnsiballZ_systemd.py' Aug 24 19:45:14 np0000008011 sudo[42420]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:45:14 np0000008011 sudo[42420]: pam_unix(sudo:session): session closed for user root Aug 24 19:45:15 np0000008011 sudo[42440]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-xmmezzskrxxesbqafvlqztzbgapljgql ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600714.9928484-10651-44354531602922/AnsiballZ_stat.py' Aug 24 19:45:15 np0000008011 sudo[42440]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:45:15 np0000008011 sudo[42440]: pam_unix(sudo:session): session closed for user root Aug 24 19:45:15 np0000008011 sudo[42451]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-ruaevoeswarmfmkbdfumcnheeavxljee ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600714.9928484-10651-44354531602922/AnsiballZ_copy.py' Aug 24 19:45:15 np0000008011 sudo[42451]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:45:15 np0000008011 sudo[42451]: pam_unix(sudo:session): session closed for user root Aug 24 19:45:15 np0000008011 sudo[42469]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-ycfwlscxesapfqauuxapvgaaswrtljzt ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600715.6364605-10667-96520690945978/AnsiballZ_file.py' Aug 24 19:45:15 np0000008011 sudo[42469]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:45:15 np0000008011 sudo[42469]: pam_unix(sudo:session): session closed for user root Aug 24 19:45:16 np0000008011 sudo[42487]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-wihoxligndiweppsiabdsbdyvfvotxcf ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600715.9913838-10675-246676272815985/AnsiballZ_get_url.py' Aug 24 19:45:16 np0000008011 sudo[42487]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:45:16 np0000008011 sudo[42487]: pam_unix(sudo:session): session closed for user root Aug 24 19:45:16 np0000008011 sudo[42505]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-zuzjnhzmfgjhmeouuzdfpbwhetnednhm ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600716.4659846-10683-62327300426512/AnsiballZ_file.py' Aug 24 19:45:16 np0000008011 sudo[42505]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:45:16 np0000008011 sudo[42505]: pam_unix(sudo:session): session closed for user root Aug 24 19:45:17 np0000008011 sudo[42523]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-figfssllfpvfqkkklzkqtssijhzeyqfn ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600716.9345527-10695-78671753622179/AnsiballZ_stat.py' Aug 24 19:45:17 np0000008011 sudo[42523]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:45:17 np0000008011 sudo[42523]: pam_unix(sudo:session): session closed for user root Aug 24 19:45:17 np0000008011 sudo[42541]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-qbfeesggnlmtrsettnycxudcjjdueunq ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600717.2925687-10703-214831399748288/AnsiballZ_command.py' Aug 24 19:45:17 np0000008011 sudo[42541]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:45:18 np0000008011 sudo[42541]: pam_unix(sudo:session): session closed for user root Aug 24 19:45:18 np0000008011 sudo[42957]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-jwulemwhrmwhhkgowfxfiepbsfyvwzdy ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600718.3478465-10715-243715896301552/AnsiballZ_command.py' Aug 24 19:45:18 np0000008011 sudo[42957]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:45:29 np0000008011 sudo[42957]: pam_unix(sudo:session): session closed for user root Aug 24 19:45:29 np0000008011 sudo[50877]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-bgwoauycqamhsufydjdweonzsrketelf ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600729.811363-10724-35409541906677/AnsiballZ_setup.py' Aug 24 19:45:29 np0000008011 sudo[50877]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:45:30 np0000008011 sudo[50877]: pam_unix(sudo:session): session closed for user root Aug 24 19:45:30 np0000008011 sudo[50915]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-imzvxbfahzsdysftocmjnygcxhsciqqd ; cat /proc/sys/kernel/random/boot_id' Aug 24 19:45:30 np0000008011 sudo[50915]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:45:30 np0000008011 sudo[50915]: pam_unix(sudo:session): session closed for user root Aug 24 19:45:30 np0000008011 sudo[50923]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-xjzjfjosqjzfhkanynnsiiuoznbzuero ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600729.811363-10724-35409541906677/AnsiballZ_find.py' Aug 24 19:45:30 np0000008011 sudo[50923]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:45:30 np0000008011 sudo[50923]: pam_unix(sudo:session): session closed for user root Aug 24 19:45:30 np0000008011 sudo[50929]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-vwmftygpoumthnhstzvysbgifuqflfhe ; /sbin/shutdown -r 0 "Reboot initiated by Ansible"' Aug 24 19:45:30 np0000008011 sudo[50929]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:45:30 np0000008011 sudo[50929]: pam_unix(sudo:session): session closed for user root Aug 24 19:45:31 np0000008011 kernel: EXT4-fs (sda16): unmounting filesystem 7dc15ce9-d090-44d7-bb05-2a36d545a8e3. -- Boot 73e2c82b1b8d49398d306b02a96d5629 -- Aug 24 19:45:39 np0000008011 kernel: Linux version 6.8.0-138-generic (buildd@lcy02-amd64-023) (x86_64-linux-gnu-gcc-13 (Ubuntu 13.3.0-6ubuntu2~24.04.1) 13.3.0, GNU ld (GNU Binutils for Ubuntu) 2.42) #138-Ubuntu SMP PREEMPT_DYNAMIC Fri Jul 31 22:41:49 UTC 2026 (Ubuntu 6.8.0-138.138-generic 6.8.12) Aug 24 19:45:39 np0000008011 kernel: Command line: BOOT_IMAGE=/vmlinuz-6.8.0-138-generic root=UUID=8515de1c-ba7e-467b-adde-6d9f8a8dbc1f ro amd_pstate=guided nofb libata.fua=1 systemd.unified_cgroup_hierarchy=0 video=vesafb:off swapaccount=1 nomodeset i915.modeset=0 vga=normal systemd.legacy_systemd_cgroup_controller=1 usbcore.autosuspend=-1 console=tty1 console=ttyS0 crashkernel=1024M Aug 24 19:45:39 np0000008011 kernel: KERNEL supported cpus: Aug 24 19:45:39 np0000008011 kernel: Intel GenuineIntel Aug 24 19:45:39 np0000008011 kernel: AMD AuthenticAMD Aug 24 19:45:39 np0000008011 kernel: Hygon HygonGenuine Aug 24 19:45:39 np0000008011 kernel: Centaur CentaurHauls Aug 24 19:45:39 np0000008011 kernel: zhaoxin Shanghai Aug 24 19:45:39 np0000008011 kernel: BIOS-provided physical RAM map: Aug 24 19:45:39 np0000008011 kernel: BIOS-e820: [mem 0x0000000000000000-0x000000000009fbff] usable Aug 24 19:45:39 np0000008011 kernel: BIOS-e820: [mem 0x000000000009fc00-0x000000000009ffff] reserved Aug 24 19:45:39 np0000008011 kernel: BIOS-e820: [mem 0x00000000000f0000-0x00000000000fffff] reserved Aug 24 19:45:39 np0000008011 kernel: BIOS-e820: [mem 0x0000000000100000-0x000000007ffdafff] usable Aug 24 19:45:39 np0000008011 kernel: BIOS-e820: [mem 0x000000007ffdb000-0x000000007fffffff] reserved Aug 24 19:45:39 np0000008011 kernel: BIOS-e820: [mem 0x00000000b0000000-0x00000000bfffffff] reserved Aug 24 19:45:39 np0000008011 kernel: BIOS-e820: [mem 0x00000000fed1c000-0x00000000fed1ffff] reserved Aug 24 19:45:39 np0000008011 kernel: BIOS-e820: [mem 0x00000000feffc000-0x00000000feffffff] reserved Aug 24 19:45:39 np0000008011 kernel: BIOS-e820: [mem 0x00000000fffc0000-0x00000000ffffffff] reserved Aug 24 19:45:39 np0000008011 kernel: BIOS-e820: [mem 0x0000000100000000-0x000000067fffffff] usable Aug 24 19:45:39 np0000008011 kernel: BIOS-e820: [mem 0x000000fd00000000-0x000000ffffffffff] reserved Aug 24 19:45:39 np0000008011 kernel: NX (Execute Disable) protection: active Aug 24 19:45:39 np0000008011 kernel: APIC: Static calls initialized Aug 24 19:45:39 np0000008011 kernel: SMBIOS 3.0.0 present. Aug 24 19:45:39 np0000008011 kernel: DMI: OpenStack Foundation OpenStack Nova, BIOS 1.16.3-debian-1.16.3-2 04/01/2014 Aug 24 19:45:39 np0000008011 kernel: Hypervisor detected: KVM Aug 24 19:45:39 np0000008011 kernel: kvm-clock: Using msrs 4b564d01 and 4b564d00 Aug 24 19:45:39 np0000008011 kernel: kvm-clock: using sched offset of 679448994448 cycles Aug 24 19:45:39 np0000008011 kernel: clocksource: kvm-clock: mask: 0xffffffffffffffff max_cycles: 0x1cd42e4dffb, max_idle_ns: 881590591483 ns Aug 24 19:45:39 np0000008011 kernel: tsc: Detected 2395.498 MHz processor Aug 24 19:45:39 np0000008011 kernel: e820: update [mem 0x00000000-0x00000fff] usable ==> reserved Aug 24 19:45:39 np0000008011 kernel: e820: remove [mem 0x000a0000-0x000fffff] usable Aug 24 19:45:39 np0000008011 kernel: last_pfn = 0x680000 max_arch_pfn = 0x400000000 Aug 24 19:45:39 np0000008011 kernel: MTRR map: 4 entries (3 fixed + 1 variable; max 19), built from 8 variable MTRRs Aug 24 19:45:39 np0000008011 kernel: x86/PAT: Configuration [0-7]: WB WC UC- UC WB WP UC- WT Aug 24 19:45:39 np0000008011 kernel: last_pfn = 0x7ffdb max_arch_pfn = 0x400000000 Aug 24 19:45:39 np0000008011 kernel: found SMP MP-table at [mem 0x000f5380-0x000f538f] Aug 24 19:45:39 np0000008011 kernel: Using GB pages for direct mapping Aug 24 19:45:39 np0000008011 kernel: RAMDISK: [mem 0x344b3000-0x36250fff] Aug 24 19:45:39 np0000008011 kernel: ACPI: Early table checksum verification disabled Aug 24 19:45:39 np0000008011 kernel: ACPI: RSDP 0x00000000000F5340 000014 (v00 BOCHS ) Aug 24 19:45:39 np0000008011 kernel: ACPI: RSDT 0x000000007FFE3A81 000034 (v01 BOCHS BXPC 00000001 BXPC 00000001) Aug 24 19:45:39 np0000008011 kernel: ACPI: FACP 0x000000007FFE3859 0000F4 (v03 BOCHS BXPC 00000001 BXPC 00000001) Aug 24 19:45:39 np0000008011 kernel: ACPI: DSDT 0x000000007FFDFB00 003D59 (v01 BOCHS BXPC 00000001 BXPC 00000001) Aug 24 19:45:39 np0000008011 kernel: ACPI: FACS 0x000000007FFDFAC0 000040 Aug 24 19:45:39 np0000008011 kernel: ACPI: APIC 0x000000007FFE394D 0000D0 (v03 BOCHS BXPC 00000001 BXPC 00000001) Aug 24 19:45:39 np0000008011 kernel: ACPI: MCFG 0x000000007FFE3A1D 00003C (v01 BOCHS BXPC 00000001 BXPC 00000001) Aug 24 19:45:39 np0000008011 kernel: ACPI: WAET 0x000000007FFE3A59 000028 (v01 BOCHS BXPC 00000001 BXPC 00000001) Aug 24 19:45:39 np0000008011 kernel: ACPI: Reserving FACP table memory at [mem 0x7ffe3859-0x7ffe394c] Aug 24 19:45:39 np0000008011 kernel: ACPI: Reserving DSDT table memory at [mem 0x7ffdfb00-0x7ffe3858] Aug 24 19:45:39 np0000008011 kernel: ACPI: Reserving FACS table memory at [mem 0x7ffdfac0-0x7ffdfaff] Aug 24 19:45:39 np0000008011 kernel: ACPI: Reserving APIC table memory at [mem 0x7ffe394d-0x7ffe3a1c] Aug 24 19:45:39 np0000008011 kernel: ACPI: Reserving MCFG table memory at [mem 0x7ffe3a1d-0x7ffe3a58] Aug 24 19:45:39 np0000008011 kernel: ACPI: Reserving WAET table memory at [mem 0x7ffe3a59-0x7ffe3a80] Aug 24 19:45:39 np0000008011 kernel: No NUMA configuration found Aug 24 19:45:39 np0000008011 kernel: Faking a node at [mem 0x0000000000000000-0x000000067fffffff] Aug 24 19:45:39 np0000008011 kernel: NODE_DATA(0) allocated [mem 0x67ffd3000-0x67fffdfff] Aug 24 19:45:39 np0000008011 kernel: crashkernel low memory reserved: 0x5f000000 - 0x6f000000 (256 MB) Aug 24 19:45:39 np0000008011 kernel: crashkernel reserved: 0x000000063f000000 - 0x000000067f000000 (1024 MB) Aug 24 19:45:39 np0000008011 kernel: Zone ranges: Aug 24 19:45:39 np0000008011 kernel: DMA [mem 0x0000000000001000-0x0000000000ffffff] Aug 24 19:45:39 np0000008011 kernel: DMA32 [mem 0x0000000001000000-0x00000000ffffffff] Aug 24 19:45:39 np0000008011 kernel: Normal [mem 0x0000000100000000-0x000000067fffffff] Aug 24 19:45:39 np0000008011 kernel: Device empty Aug 24 19:45:39 np0000008011 kernel: Movable zone start for each node Aug 24 19:45:39 np0000008011 kernel: Early memory node ranges Aug 24 19:45:39 np0000008011 kernel: node 0: [mem 0x0000000000001000-0x000000000009efff] Aug 24 19:45:39 np0000008011 kernel: node 0: [mem 0x0000000000100000-0x000000007ffdafff] Aug 24 19:45:39 np0000008011 kernel: node 0: [mem 0x0000000100000000-0x000000067fffffff] Aug 24 19:45:39 np0000008011 kernel: Initmem setup node 0 [mem 0x0000000000001000-0x000000067fffffff] Aug 24 19:45:39 np0000008011 kernel: On node 0, zone DMA: 1 pages in unavailable ranges Aug 24 19:45:39 np0000008011 kernel: On node 0, zone DMA: 97 pages in unavailable ranges Aug 24 19:45:39 np0000008011 kernel: On node 0, zone Normal: 37 pages in unavailable ranges Aug 24 19:45:39 np0000008011 kernel: ACPI: PM-Timer IO Port: 0x608 Aug 24 19:45:39 np0000008011 kernel: ACPI: LAPIC_NMI (acpi_id[0xff] dfl dfl lint[0x1]) Aug 24 19:45:39 np0000008011 kernel: IOAPIC[0]: apic_id 0, version 17, address 0xfec00000, GSI 0-23 Aug 24 19:45:39 np0000008011 kernel: ACPI: INT_SRC_OVR (bus 0 bus_irq 0 global_irq 2 dfl dfl) Aug 24 19:45:39 np0000008011 kernel: ACPI: INT_SRC_OVR (bus 0 bus_irq 5 global_irq 5 high level) Aug 24 19:45:39 np0000008011 kernel: ACPI: INT_SRC_OVR (bus 0 bus_irq 9 global_irq 9 high level) Aug 24 19:45:39 np0000008011 kernel: ACPI: INT_SRC_OVR (bus 0 bus_irq 10 global_irq 10 high level) Aug 24 19:45:39 np0000008011 kernel: ACPI: INT_SRC_OVR (bus 0 bus_irq 11 global_irq 11 high level) Aug 24 19:45:39 np0000008011 kernel: ACPI: Using ACPI (MADT) for SMP configuration information Aug 24 19:45:39 np0000008011 kernel: TSC deadline timer available Aug 24 19:45:39 np0000008011 kernel: smpboot: Allowing 12 CPUs, 0 hotplug CPUs Aug 24 19:45:39 np0000008011 kernel: kvm-guest: APIC: eoi() replaced with kvm_guest_apic_eoi_write() Aug 24 19:45:39 np0000008011 kernel: PM: hibernation: Registered nosave memory: [mem 0x00000000-0x00000fff] Aug 24 19:45:39 np0000008011 kernel: PM: hibernation: Registered nosave memory: [mem 0x0009f000-0x000fffff] Aug 24 19:45:39 np0000008011 kernel: PM: hibernation: Registered nosave memory: [mem 0x7ffdb000-0xffffffff] Aug 24 19:45:39 np0000008011 kernel: [mem 0xc0000000-0xfed1bfff] available for PCI devices Aug 24 19:45:39 np0000008011 kernel: Booting paravirtualized kernel on KVM Aug 24 19:45:39 np0000008011 kernel: clocksource: refined-jiffies: mask: 0xffffffff max_cycles: 0xffffffff, max_idle_ns: 1910969940391419 ns Aug 24 19:45:39 np0000008011 kernel: setup_percpu: NR_CPUS:8192 nr_cpumask_bits:12 nr_cpu_ids:12 nr_node_ids:1 Aug 24 19:45:39 np0000008011 kernel: percpu: Embedded 86 pages/cpu s229376 r8192 d114688 u524288 Aug 24 19:45:39 np0000008011 kernel: pcpu-alloc: s229376 r8192 d114688 u524288 alloc=1*2097152 Aug 24 19:45:39 np0000008011 kernel: pcpu-alloc: [0] 00 01 02 03 [0] 04 05 06 07 Aug 24 19:45:39 np0000008011 kernel: pcpu-alloc: [0] 08 09 10 11 Aug 24 19:45:39 np0000008011 kernel: kvm-guest: PV spinlocks disabled, no host support Aug 24 19:45:39 np0000008011 kernel: Kernel command line: BOOT_IMAGE=/vmlinuz-6.8.0-138-generic root=UUID=8515de1c-ba7e-467b-adde-6d9f8a8dbc1f ro amd_pstate=guided nofb libata.fua=1 systemd.unified_cgroup_hierarchy=0 video=vesafb:off swapaccount=1 nomodeset i915.modeset=0 vga=normal systemd.legacy_systemd_cgroup_controller=1 usbcore.autosuspend=-1 console=tty1 console=ttyS0 crashkernel=1024M Aug 24 19:45:39 np0000008011 kernel: Booted with the nomodeset parameter. Only the system framebuffer will be available Aug 24 19:45:39 np0000008011 kernel: Unknown kernel command line parameters "nofb vga=normal", will be passed to user space. Aug 24 19:45:39 np0000008011 kernel: random: crng init done Aug 24 19:45:39 np0000008011 kernel: Dentry cache hash table entries: 4194304 (order: 13, 33554432 bytes, linear) Aug 24 19:45:39 np0000008011 kernel: Inode-cache hash table entries: 2097152 (order: 12, 16777216 bytes, linear) Aug 24 19:45:39 np0000008011 kernel: Fallback order for Node 0: 0 Aug 24 19:45:39 np0000008011 kernel: Built 1 zonelists, mobility grouping on. Total pages: 6192859 Aug 24 19:45:39 np0000008011 kernel: Policy zone: Normal Aug 24 19:45:39 np0000008011 kernel: mem auto-init: stack:all(zero), heap alloc:on, heap free:off Aug 24 19:45:39 np0000008011 kernel: software IO TLB: area num 16. Aug 24 19:45:39 np0000008011 kernel: Memory: 23256892K/25165284K available (22528K kernel code, 4441K rwdata, 14428K rodata, 4932K init, 4776K bss, 1908132K reserved, 0K cma-reserved) Aug 24 19:45:39 np0000008011 kernel: SLUB: HWalign=64, Order=0-3, MinObjects=0, CPUs=12, Nodes=1 Aug 24 19:45:39 np0000008011 kernel: ftrace: allocating 58334 entries in 228 pages Aug 24 19:45:39 np0000008011 kernel: ftrace: allocated 228 pages with 4 groups Aug 24 19:45:39 np0000008011 kernel: Dynamic Preempt: voluntary Aug 24 19:45:39 np0000008011 kernel: rcu: Preemptible hierarchical RCU implementation. Aug 24 19:45:39 np0000008011 kernel: rcu: RCU restricting CPUs from NR_CPUS=8192 to nr_cpu_ids=12. Aug 24 19:45:39 np0000008011 kernel: Trampoline variant of Tasks RCU enabled. Aug 24 19:45:39 np0000008011 kernel: Rude variant of Tasks RCU enabled. Aug 24 19:45:39 np0000008011 kernel: Tracing variant of Tasks RCU enabled. Aug 24 19:45:39 np0000008011 kernel: rcu: RCU calculated value of scheduler-enlistment delay is 100 jiffies. Aug 24 19:45:39 np0000008011 kernel: rcu: Adjusting geometry for rcu_fanout_leaf=16, nr_cpu_ids=12 Aug 24 19:45:39 np0000008011 kernel: RCU Tasks: Setting shift to 4 and lim to 1 rcu_task_cb_adjust=1 rcu_task_cpu_ids=12. Aug 24 19:45:39 np0000008011 kernel: RCU Tasks Rude: Setting shift to 4 and lim to 1 rcu_task_cb_adjust=1 rcu_task_cpu_ids=12. Aug 24 19:45:39 np0000008011 kernel: RCU Tasks Trace: Setting shift to 4 and lim to 1 rcu_task_cb_adjust=1 rcu_task_cpu_ids=12. Aug 24 19:45:39 np0000008011 kernel: NR_IRQS: 524544, nr_irqs: 520, preallocated irqs: 16 Aug 24 19:45:39 np0000008011 kernel: rcu: srcu_init: Setting srcu_struct sizes based on contention. Aug 24 19:45:39 np0000008011 kernel: Console: colour VGA+ 80x25 Aug 24 19:45:39 np0000008011 kernel: printk: legacy console [tty1] enabled Aug 24 19:45:39 np0000008011 kernel: printk: legacy console [ttyS0] enabled Aug 24 19:45:39 np0000008011 kernel: ACPI: Core revision 20230628 Aug 24 19:45:39 np0000008011 kernel: APIC: Switch to symmetric I/O mode setup Aug 24 19:45:39 np0000008011 kernel: x2apic enabled Aug 24 19:45:39 np0000008011 kernel: APIC: Switched APIC routing to: physical x2apic Aug 24 19:45:39 np0000008011 kernel: tsc: Marking TSC unstable due to TSCs unsynchronized Aug 24 19:45:39 np0000008011 kernel: Calibrating delay loop (skipped) preset value.. 4790.99 BogoMIPS (lpj=2395498) Aug 24 19:45:39 np0000008011 kernel: x86/cpu: User Mode Instruction Prevention (UMIP) activated Aug 24 19:45:39 np0000008011 kernel: Last level iTLB entries: 4KB 512, 2MB 255, 4MB 127 Aug 24 19:45:39 np0000008011 kernel: Last level dTLB entries: 4KB 512, 2MB 255, 4MB 127, 1GB 0 Aug 24 19:45:39 np0000008011 kernel: Spectre V1 : Mitigation: usercopy/swapgs barriers and __user pointer sanitization Aug 24 19:45:39 np0000008011 kernel: Spectre V2 : Mitigation: Retpolines Aug 24 19:45:39 np0000008011 kernel: Spectre V2 : Spectre v2 / SpectreRSB: Filling RSB on context switch and VMEXIT Aug 24 19:45:39 np0000008011 kernel: Spectre V2 : Enabling Restricted Speculation for firmware calls Aug 24 19:45:39 np0000008011 kernel: Spectre V2 : mitigation: Enabling conditional Indirect Branch Prediction Barrier Aug 24 19:45:39 np0000008011 kernel: Speculative Store Bypass: Mitigation: Speculative Store Bypass disabled via prctl Aug 24 19:45:39 np0000008011 kernel: Speculative Return Stack Overflow: IBPB-extending microcode not applied! Aug 24 19:45:39 np0000008011 kernel: Speculative Return Stack Overflow: WARNING: See https://kernel.org/doc/html/latest/admin-guide/hw-vuln/srso.html for mitigation options. Aug 24 19:45:39 np0000008011 kernel: active return thunk: srso_alias_return_thunk Aug 24 19:45:39 np0000008011 kernel: Speculative Return Stack Overflow: Vulnerable: Safe RET, no microcode Aug 24 19:45:39 np0000008011 kernel: Transient Scheduler Attacks: Forcing mitigation on in a VM Aug 24 19:45:39 np0000008011 kernel: Transient Scheduler Attacks: Vulnerable: Clear CPU buffers attempted, no microcode Aug 24 19:45:39 np0000008011 kernel: x86/fpu: Supporting XSAVE feature 0x001: 'x87 floating point registers' Aug 24 19:45:39 np0000008011 kernel: x86/fpu: Supporting XSAVE feature 0x002: 'SSE registers' Aug 24 19:45:39 np0000008011 kernel: x86/fpu: Supporting XSAVE feature 0x004: 'AVX registers' Aug 24 19:45:39 np0000008011 kernel: x86/fpu: Supporting XSAVE feature 0x200: 'Protection Keys User registers' Aug 24 19:45:39 np0000008011 kernel: x86/fpu: xstate_offset[2]: 576, xstate_sizes[2]: 256 Aug 24 19:45:39 np0000008011 kernel: x86/fpu: xstate_offset[9]: 832, xstate_sizes[9]: 8 Aug 24 19:45:39 np0000008011 kernel: x86/fpu: Enabled xstate features 0x207, context size is 840 bytes, using 'compacted' format. Aug 24 19:45:39 np0000008011 kernel: Freeing SMP alternatives memory: 48K Aug 24 19:45:39 np0000008011 kernel: pid_max: default: 32768 minimum: 301 Aug 24 19:45:39 np0000008011 kernel: LSM: initializing lsm=lockdown,capability,landlock,yama,apparmor,integrity Aug 24 19:45:39 np0000008011 kernel: landlock: Up and running. Aug 24 19:45:39 np0000008011 kernel: Yama: becoming mindful. Aug 24 19:45:39 np0000008011 kernel: AppArmor: AppArmor initialized Aug 24 19:45:39 np0000008011 kernel: Mount-cache hash table entries: 65536 (order: 7, 524288 bytes, linear) Aug 24 19:45:39 np0000008011 kernel: Mountpoint-cache hash table entries: 65536 (order: 7, 524288 bytes, linear) Aug 24 19:45:39 np0000008011 kernel: smpboot: CPU0: AMD EPYC-Milan Processor (family: 0x19, model: 0x1, stepping: 0x1) Aug 24 19:45:39 np0000008011 kernel: Performance Events: Fam17h+ core perfctr, AMD PMU driver. Aug 24 19:45:39 np0000008011 kernel: ... version: 0 Aug 24 19:45:39 np0000008011 kernel: ... bit width: 48 Aug 24 19:45:39 np0000008011 kernel: ... generic registers: 6 Aug 24 19:45:39 np0000008011 kernel: ... value mask: 0000ffffffffffff Aug 24 19:45:39 np0000008011 kernel: ... max period: 00007fffffffffff Aug 24 19:45:39 np0000008011 kernel: ... fixed-purpose events: 0 Aug 24 19:45:39 np0000008011 kernel: ... event mask: 000000000000003f Aug 24 19:45:39 np0000008011 kernel: signal: max sigframe size: 3376 Aug 24 19:45:39 np0000008011 kernel: rcu: Hierarchical SRCU implementation. Aug 24 19:45:39 np0000008011 kernel: rcu: Max phase no-delay instances is 400. Aug 24 19:45:39 np0000008011 kernel: smp: Bringing up secondary CPUs ... Aug 24 19:45:39 np0000008011 kernel: smpboot: x86: Booting SMP configuration: Aug 24 19:45:39 np0000008011 kernel: .... node #0, CPUs: #1 #2 #3 #4 #5 #6 #7 #8 #9 #10 #11 Aug 24 19:45:39 np0000008011 kernel: smp: Brought up 1 node, 12 CPUs Aug 24 19:45:39 np0000008011 kernel: smpboot: Max logical packages: 12 Aug 24 19:45:39 np0000008011 kernel: smpboot: Total of 12 processors activated (57491.95 BogoMIPS) Aug 24 19:45:39 np0000008011 kernel: devtmpfs: initialized Aug 24 19:45:39 np0000008011 kernel: x86/mm: Memory block size: 128MB Aug 24 19:45:39 np0000008011 kernel: clocksource: jiffies: mask: 0xffffffff max_cycles: 0xffffffff, max_idle_ns: 1911260446275000 ns Aug 24 19:45:39 np0000008011 kernel: futex hash table entries: 4096 (order: 6, 262144 bytes, linear) Aug 24 19:45:39 np0000008011 kernel: pinctrl core: initialized pinctrl subsystem Aug 24 19:45:39 np0000008011 kernel: PM: RTC time: 19:45:37, date: 2026-08-24 Aug 24 19:45:39 np0000008011 kernel: NET: Registered PF_NETLINK/PF_ROUTE protocol family Aug 24 19:45:39 np0000008011 kernel: DMA: preallocated 4096 KiB GFP_KERNEL pool for atomic allocations Aug 24 19:45:39 np0000008011 kernel: DMA: preallocated 4096 KiB GFP_KERNEL|GFP_DMA pool for atomic allocations Aug 24 19:45:39 np0000008011 kernel: DMA: preallocated 4096 KiB GFP_KERNEL|GFP_DMA32 pool for atomic allocations Aug 24 19:45:39 np0000008011 kernel: audit: initializing netlink subsys (disabled) Aug 24 19:45:39 np0000008011 kernel: audit: type=2000 audit(1787600737.118:1): state=initialized audit_enabled=0 res=1 Aug 24 19:45:39 np0000008011 kernel: thermal_sys: Registered thermal governor 'fair_share' Aug 24 19:45:39 np0000008011 kernel: thermal_sys: Registered thermal governor 'bang_bang' Aug 24 19:45:39 np0000008011 kernel: thermal_sys: Registered thermal governor 'step_wise' Aug 24 19:45:39 np0000008011 kernel: thermal_sys: Registered thermal governor 'user_space' Aug 24 19:45:39 np0000008011 kernel: thermal_sys: Registered thermal governor 'power_allocator' Aug 24 19:45:39 np0000008011 kernel: cpuidle: using governor ladder Aug 24 19:45:39 np0000008011 kernel: cpuidle: using governor menu Aug 24 19:45:39 np0000008011 kernel: acpiphp: ACPI Hot Plug PCI Controller Driver version: 0.5 Aug 24 19:45:39 np0000008011 kernel: PCI: ECAM [mem 0xb0000000-0xbfffffff] (base 0xb0000000) for domain 0000 [bus 00-ff] Aug 24 19:45:39 np0000008011 kernel: PCI: ECAM [mem 0xb0000000-0xbfffffff] reserved as E820 entry Aug 24 19:45:39 np0000008011 kernel: PCI: Using configuration type 1 for base access Aug 24 19:45:39 np0000008011 kernel: kprobes: kprobe jump-optimization is enabled. All kprobes are optimized if possible. Aug 24 19:45:39 np0000008011 kernel: HugeTLB: registered 1.00 GiB page size, pre-allocated 0 pages Aug 24 19:45:39 np0000008011 kernel: HugeTLB: 16380 KiB vmemmap can be freed for a 1.00 GiB page Aug 24 19:45:39 np0000008011 kernel: HugeTLB: registered 2.00 MiB page size, pre-allocated 0 pages Aug 24 19:45:39 np0000008011 kernel: HugeTLB: 28 KiB vmemmap can be freed for a 2.00 MiB page Aug 24 19:45:39 np0000008011 kernel: ACPI: Added _OSI(Module Device) Aug 24 19:45:39 np0000008011 kernel: ACPI: Added _OSI(Processor Device) Aug 24 19:45:39 np0000008011 kernel: ACPI: Added _OSI(Processor Aggregator Device) Aug 24 19:45:39 np0000008011 kernel: ACPI: 1 ACPI AML tables successfully acquired and loaded Aug 24 19:45:39 np0000008011 kernel: ACPI: _OSC evaluation for CPUs failed, trying _PDC Aug 24 19:45:39 np0000008011 kernel: ACPI: Interpreter enabled Aug 24 19:45:39 np0000008011 kernel: ACPI: PM: (supports S0 S3 S4 S5) Aug 24 19:45:39 np0000008011 kernel: ACPI: Using IOAPIC for interrupt routing Aug 24 19:45:39 np0000008011 kernel: PCI: Using host bridge windows from ACPI; if necessary, use "pci=nocrs" and report a bug Aug 24 19:45:39 np0000008011 kernel: PCI: Using E820 reservations for host bridge windows Aug 24 19:45:39 np0000008011 kernel: ACPI: Enabled 2 GPEs in block 00 to 3F Aug 24 19:45:39 np0000008011 kernel: ACPI: PCI Root Bridge [PCI0] (domain 0000 [bus 00-ff]) Aug 24 19:45:39 np0000008011 kernel: acpi PNP0A08:00: _OSC: OS supports [ExtendedConfig ASPM ClockPM Segments MSI EDR HPX-Type3] Aug 24 19:45:39 np0000008011 kernel: acpi PNP0A08:00: _OSC: platform does not support [PCIeHotplug LTR DPC] Aug 24 19:45:39 np0000008011 kernel: acpi PNP0A08:00: _OSC: OS now controls [SHPCHotplug PME AER PCIeCapability] Aug 24 19:45:39 np0000008011 kernel: PCI host bridge to bus 0000:00 Aug 24 19:45:39 np0000008011 kernel: pci_bus 0000:00: root bus resource [io 0x0000-0x0cf7 window] Aug 24 19:45:39 np0000008011 kernel: pci_bus 0000:00: root bus resource [io 0x0d00-0xffff window] Aug 24 19:45:39 np0000008011 kernel: pci_bus 0000:00: root bus resource [mem 0x000a0000-0x000bffff window] Aug 24 19:45:39 np0000008011 kernel: pci_bus 0000:00: root bus resource [mem 0x80000000-0xafffffff window] Aug 24 19:45:39 np0000008011 kernel: pci_bus 0000:00: root bus resource [mem 0xc0000000-0xfebfffff window] Aug 24 19:45:39 np0000008011 kernel: pci_bus 0000:00: root bus resource [mem 0xc000000000-0xc7ffffffff window] Aug 24 19:45:39 np0000008011 kernel: pci_bus 0000:00: root bus resource [bus 00-ff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:00.0: [8086:29c0] type 00 class 0x060000 conventional PCI endpoint Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:01.0: [1af4:1050] type 00 class 0x030000 conventional PCI endpoint Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:01.0: BAR 0 [mem 0xfb800000-0xfbffffff pref] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:01.0: BAR 2 [mem 0xc220000000-0xc220003fff 64bit pref] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:01.0: BAR 4 [mem 0xfea10000-0xfea10fff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:01.0: ROM [mem 0xfea00000-0xfea0ffff pref] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:01.0: Video device with shadowed ROM at [mem 0x000c0000-0x000dffff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.0: [1b36:000c] type 01 class 0x060400 PCIe Root Port Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.0: BAR 0 [mem 0xfea11000-0xfea11fff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.0: PCI bridge to [bus 01-02] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.0: bridge window [io 0xc000-0xcfff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.0: bridge window [mem 0xfc600000-0xfc9fffff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.0: bridge window [mem 0xc200000000-0xc21fffffff 64bit pref] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.1: [1b36:000c] type 01 class 0x060400 PCIe Root Port Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.1: BAR 0 [mem 0xfea12000-0xfea12fff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.1: PCI bridge to [bus 03] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.1: bridge window [mem 0xfe800000-0xfe9fffff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.1: bridge window [mem 0xc1e0000000-0xc1ffffffff 64bit pref] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.2: [1b36:000c] type 01 class 0x060400 PCIe Root Port Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.2: BAR 0 [mem 0xfea13000-0xfea13fff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.2: PCI bridge to [bus 04] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.2: bridge window [mem 0xfe600000-0xfe7fffff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.2: bridge window [mem 0xc1c0000000-0xc1dfffffff 64bit pref] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.3: [1b36:000c] type 01 class 0x060400 PCIe Root Port Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.3: BAR 0 [mem 0xfea14000-0xfea14fff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.3: PCI bridge to [bus 05] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.3: bridge window [mem 0xfe400000-0xfe5fffff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.3: bridge window [mem 0xc1a0000000-0xc1bfffffff 64bit pref] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.4: [1b36:000c] type 01 class 0x060400 PCIe Root Port Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.4: BAR 0 [mem 0xfea15000-0xfea15fff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.4: PCI bridge to [bus 06] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.4: bridge window [mem 0xfe200000-0xfe3fffff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.4: bridge window [mem 0xc180000000-0xc19fffffff 64bit pref] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.5: [1b36:000c] type 01 class 0x060400 PCIe Root Port Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.5: BAR 0 [mem 0xfea16000-0xfea16fff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.5: PCI bridge to [bus 07] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.5: bridge window [mem 0xfe000000-0xfe1fffff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.5: bridge window [mem 0xc160000000-0xc17fffffff 64bit pref] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.6: [1b36:000c] type 01 class 0x060400 PCIe Root Port Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.6: BAR 0 [mem 0xfea17000-0xfea17fff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.6: PCI bridge to [bus 08] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.6: bridge window [mem 0xfde00000-0xfdffffff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.6: bridge window [mem 0xc140000000-0xc15fffffff 64bit pref] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.7: [1b36:000c] type 01 class 0x060400 PCIe Root Port Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.7: BAR 0 [mem 0xfea18000-0xfea18fff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.7: PCI bridge to [bus 09] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.7: bridge window [mem 0xfdc00000-0xfddfffff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.7: bridge window [mem 0xc120000000-0xc13fffffff 64bit pref] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.0: [1b36:000c] type 01 class 0x060400 PCIe Root Port Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.0: BAR 0 [mem 0xfea19000-0xfea19fff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.0: PCI bridge to [bus 0a] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.0: bridge window [mem 0xfda00000-0xfdbfffff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.0: bridge window [mem 0xc100000000-0xc11fffffff 64bit pref] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.1: [1b36:000c] type 01 class 0x060400 PCIe Root Port Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.1: BAR 0 [mem 0xfea1a000-0xfea1afff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.1: PCI bridge to [bus 0b] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.1: bridge window [mem 0xfd800000-0xfd9fffff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.1: bridge window [mem 0xc0e0000000-0xc0ffffffff 64bit pref] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.2: [1b36:000c] type 01 class 0x060400 PCIe Root Port Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.2: BAR 0 [mem 0xfea1b000-0xfea1bfff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.2: PCI bridge to [bus 0c] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.2: bridge window [mem 0xfd600000-0xfd7fffff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.2: bridge window [mem 0xc0c0000000-0xc0dfffffff 64bit pref] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.3: [1b36:000c] type 01 class 0x060400 PCIe Root Port Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.3: BAR 0 [mem 0xfea1c000-0xfea1cfff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.3: PCI bridge to [bus 0d] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.3: bridge window [mem 0xfd400000-0xfd5fffff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.3: bridge window [mem 0xc0a0000000-0xc0bfffffff 64bit pref] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.4: [1b36:000c] type 01 class 0x060400 PCIe Root Port Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.4: BAR 0 [mem 0xfea1d000-0xfea1dfff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.4: PCI bridge to [bus 0e] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.4: bridge window [mem 0xfd200000-0xfd3fffff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.4: bridge window [mem 0xc080000000-0xc09fffffff 64bit pref] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.5: [1b36:000c] type 01 class 0x060400 PCIe Root Port Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.5: BAR 0 [mem 0xfea1e000-0xfea1efff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.5: PCI bridge to [bus 0f] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.5: bridge window [mem 0xfd000000-0xfd1fffff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.5: bridge window [mem 0xc060000000-0xc07fffffff 64bit pref] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.6: [1b36:000c] type 01 class 0x060400 PCIe Root Port Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.6: BAR 0 [mem 0xfea1f000-0xfea1ffff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.6: PCI bridge to [bus 10] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.6: bridge window [mem 0xfce00000-0xfcffffff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.6: bridge window [mem 0xc040000000-0xc05fffffff 64bit pref] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.7: [1b36:000c] type 01 class 0x060400 PCIe Root Port Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.7: BAR 0 [mem 0xfea20000-0xfea20fff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.7: PCI bridge to [bus 11] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.7: bridge window [mem 0xfcc00000-0xfcdfffff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.7: bridge window [mem 0xc020000000-0xc03fffffff 64bit pref] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:04.0: [1b36:000c] type 01 class 0x060400 PCIe Root Port Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:04.0: BAR 0 [mem 0xfea21000-0xfea21fff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:04.0: PCI bridge to [bus 12] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:04.0: bridge window [mem 0xfca00000-0xfcbfffff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:04.0: bridge window [mem 0xc000000000-0xc01fffffff 64bit pref] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:1f.0: [8086:2918] type 00 class 0x060100 conventional PCI endpoint Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:1f.0: quirk: [io 0x0600-0x067f] claimed by ICH6 ACPI/GPIO/TCO Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:1f.2: [8086:2922] type 00 class 0x010601 conventional PCI endpoint Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:1f.2: BAR 4 [io 0xd040-0xd05f] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:1f.2: BAR 5 [mem 0xfea22000-0xfea22fff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:1f.3: [8086:2930] type 00 class 0x0c0500 conventional PCI endpoint Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:1f.3: BAR 4 [io 0x0700-0x073f] Aug 24 19:45:39 np0000008011 kernel: pci 0000:01:00.0: [1b36:000e] type 01 class 0x060400 PCIe to PCI/PCI-X bridge Aug 24 19:45:39 np0000008011 kernel: pci 0000:01:00.0: BAR 0 [mem 0xfc800000-0xfc8000ff 64bit] Aug 24 19:45:39 np0000008011 kernel: pci 0000:01:00.0: PCI bridge to [bus 02] Aug 24 19:45:39 np0000008011 kernel: pci 0000:01:00.0: bridge window [io 0xc000-0xcfff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:01:00.0: bridge window [mem 0xfc600000-0xfc7fffff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:01:00.0: bridge window [mem 0xc200000000-0xc21fffffff 64bit pref] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.0: PCI bridge to [bus 01-02] Aug 24 19:45:39 np0000008011 kernel: pci_bus 0000:02: extended config space not accessible Aug 24 19:45:39 np0000008011 kernel: acpiphp: Slot [1] registered Aug 24 19:45:39 np0000008011 kernel: acpiphp: Slot [0] registered Aug 24 19:45:39 np0000008011 kernel: acpiphp: Slot [2] registered Aug 24 19:45:39 np0000008011 kernel: acpiphp: Slot [3] registered Aug 24 19:45:39 np0000008011 kernel: acpiphp: Slot [4] registered Aug 24 19:45:39 np0000008011 kernel: acpiphp: Slot [5] registered Aug 24 19:45:39 np0000008011 kernel: acpiphp: Slot [6] registered Aug 24 19:45:39 np0000008011 kernel: acpiphp: Slot [7] registered Aug 24 19:45:39 np0000008011 kernel: acpiphp: Slot [8] registered Aug 24 19:45:39 np0000008011 kernel: acpiphp: Slot [9] registered Aug 24 19:45:39 np0000008011 kernel: acpiphp: Slot [10] registered Aug 24 19:45:39 np0000008011 kernel: acpiphp: Slot [11] registered Aug 24 19:45:39 np0000008011 kernel: acpiphp: Slot [12] registered Aug 24 19:45:39 np0000008011 kernel: acpiphp: Slot [13] registered Aug 24 19:45:39 np0000008011 kernel: acpiphp: Slot [14] registered Aug 24 19:45:39 np0000008011 kernel: acpiphp: Slot [15] registered Aug 24 19:45:39 np0000008011 kernel: acpiphp: Slot [16] registered Aug 24 19:45:39 np0000008011 kernel: acpiphp: Slot [17] registered Aug 24 19:45:39 np0000008011 kernel: acpiphp: Slot [18] registered Aug 24 19:45:39 np0000008011 kernel: acpiphp: Slot [19] registered Aug 24 19:45:39 np0000008011 kernel: acpiphp: Slot [20] registered Aug 24 19:45:39 np0000008011 kernel: acpiphp: Slot [21] registered Aug 24 19:45:39 np0000008011 kernel: acpiphp: Slot [22] registered Aug 24 19:45:39 np0000008011 kernel: acpiphp: Slot [23] registered Aug 24 19:45:39 np0000008011 kernel: acpiphp: Slot [24] registered Aug 24 19:45:39 np0000008011 kernel: acpiphp: Slot [25] registered Aug 24 19:45:39 np0000008011 kernel: acpiphp: Slot [26] registered Aug 24 19:45:39 np0000008011 kernel: acpiphp: Slot [27] registered Aug 24 19:45:39 np0000008011 kernel: acpiphp: Slot [28] registered Aug 24 19:45:39 np0000008011 kernel: acpiphp: Slot [29] registered Aug 24 19:45:39 np0000008011 kernel: acpiphp: Slot [30] registered Aug 24 19:45:39 np0000008011 kernel: acpiphp: Slot [31] registered Aug 24 19:45:39 np0000008011 kernel: pci 0000:02:01.0: [8086:7020] type 00 class 0x0c0300 conventional PCI endpoint Aug 24 19:45:39 np0000008011 kernel: pci 0000:02:01.0: BAR 4 [io 0xc000-0xc01f] Aug 24 19:45:39 np0000008011 kernel: pci 0000:01:00.0: PCI bridge to [bus 02] Aug 24 19:45:39 np0000008011 kernel: acpiphp: Slot [0-2] registered Aug 24 19:45:39 np0000008011 kernel: pci 0000:03:00.0: [1af4:1041] type 00 class 0x020000 PCIe Endpoint Aug 24 19:45:39 np0000008011 kernel: pci 0000:03:00.0: BAR 1 [mem 0xfe880000-0xfe880fff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:03:00.0: BAR 4 [mem 0xc1e0000000-0xc1e0003fff 64bit pref] Aug 24 19:45:39 np0000008011 kernel: pci 0000:03:00.0: ROM [mem 0xfe800000-0xfe87ffff pref] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.1: PCI bridge to [bus 03] Aug 24 19:45:39 np0000008011 kernel: acpiphp: Slot [0-3] registered Aug 24 19:45:39 np0000008011 kernel: pci 0000:04:00.0: [1af4:1048] type 00 class 0x010000 PCIe Endpoint Aug 24 19:45:39 np0000008011 kernel: pci 0000:04:00.0: BAR 1 [mem 0xfe600000-0xfe600fff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:04:00.0: BAR 4 [mem 0xc1c0000000-0xc1c0003fff 64bit pref] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.2: PCI bridge to [bus 04] Aug 24 19:45:39 np0000008011 kernel: acpiphp: Slot [0-4] registered Aug 24 19:45:39 np0000008011 kernel: pci 0000:05:00.0: [1af4:1045] type 00 class 0x00ff00 PCIe Endpoint Aug 24 19:45:39 np0000008011 kernel: pci 0000:05:00.0: BAR 4 [mem 0xc1a0000000-0xc1a0003fff 64bit pref] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.3: PCI bridge to [bus 05] Aug 24 19:45:39 np0000008011 kernel: acpiphp: Slot [0-5] registered Aug 24 19:45:39 np0000008011 kernel: pci 0000:06:00.0: [1af4:1044] type 00 class 0x00ff00 PCIe Endpoint Aug 24 19:45:39 np0000008011 kernel: pci 0000:06:00.0: BAR 1 [mem 0xfe200000-0xfe200fff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:06:00.0: BAR 4 [mem 0xc180000000-0xc180003fff 64bit pref] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.4: PCI bridge to [bus 06] Aug 24 19:45:39 np0000008011 kernel: acpiphp: Slot [0-6] registered Aug 24 19:45:39 np0000008011 kernel: pci 0000:07:00.0: [1af4:1041] type 00 class 0x020000 PCIe Endpoint Aug 24 19:45:39 np0000008011 kernel: pci 0000:07:00.0: BAR 1 [mem 0xfe080000-0xfe080fff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:07:00.0: BAR 4 [mem 0xc160000000-0xc160003fff 64bit pref] Aug 24 19:45:39 np0000008011 kernel: pci 0000:07:00.0: ROM [mem 0xfe000000-0xfe07ffff pref] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.5: PCI bridge to [bus 07] Aug 24 19:45:39 np0000008011 kernel: acpiphp: Slot [0-7] registered Aug 24 19:45:39 np0000008011 kernel: pci 0000:08:00.0: [1af4:1041] type 00 class 0x020000 PCIe Endpoint Aug 24 19:45:39 np0000008011 kernel: pci 0000:08:00.0: BAR 1 [mem 0xfde80000-0xfde80fff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:08:00.0: BAR 4 [mem 0xc140000000-0xc140003fff 64bit pref] Aug 24 19:45:39 np0000008011 kernel: pci 0000:08:00.0: ROM [mem 0xfde00000-0xfde7ffff pref] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.6: PCI bridge to [bus 08] Aug 24 19:45:39 np0000008011 kernel: acpiphp: Slot [0-8] registered Aug 24 19:45:39 np0000008011 kernel: pci 0000:09:00.0: [1af4:1041] type 00 class 0x020000 PCIe Endpoint Aug 24 19:45:39 np0000008011 kernel: pci 0000:09:00.0: BAR 1 [mem 0xfdc80000-0xfdc80fff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:09:00.0: BAR 4 [mem 0xc120000000-0xc120003fff 64bit pref] Aug 24 19:45:39 np0000008011 kernel: pci 0000:09:00.0: ROM [mem 0xfdc00000-0xfdc7ffff pref] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.7: PCI bridge to [bus 09] Aug 24 19:45:39 np0000008011 kernel: acpiphp: Slot [0-9] registered Aug 24 19:45:39 np0000008011 kernel: pci 0000:0a:00.0: [1af4:1041] type 00 class 0x020000 PCIe Endpoint Aug 24 19:45:39 np0000008011 kernel: pci 0000:0a:00.0: BAR 1 [mem 0xfda80000-0xfda80fff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:0a:00.0: BAR 4 [mem 0xc100000000-0xc100003fff 64bit pref] Aug 24 19:45:39 np0000008011 kernel: pci 0000:0a:00.0: ROM [mem 0xfda00000-0xfda7ffff pref] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.0: PCI bridge to [bus 0a] Aug 24 19:45:39 np0000008011 kernel: acpiphp: Slot [0-10] registered Aug 24 19:45:39 np0000008011 kernel: pci 0000:0b:00.0: [1af4:1041] type 00 class 0x020000 PCIe Endpoint Aug 24 19:45:39 np0000008011 kernel: pci 0000:0b:00.0: BAR 1 [mem 0xfd880000-0xfd880fff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:0b:00.0: BAR 4 [mem 0xc0e0000000-0xc0e0003fff 64bit pref] Aug 24 19:45:39 np0000008011 kernel: pci 0000:0b:00.0: ROM [mem 0xfd800000-0xfd87ffff pref] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.1: PCI bridge to [bus 0b] Aug 24 19:45:39 np0000008011 kernel: acpiphp: Slot [0-11] registered Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.2: PCI bridge to [bus 0c] Aug 24 19:45:39 np0000008011 kernel: acpiphp: Slot [0-12] registered Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.3: PCI bridge to [bus 0d] Aug 24 19:45:39 np0000008011 kernel: acpiphp: Slot [0-13] registered Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.4: PCI bridge to [bus 0e] Aug 24 19:45:39 np0000008011 kernel: acpiphp: Slot [0-14] registered Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.5: PCI bridge to [bus 0f] Aug 24 19:45:39 np0000008011 kernel: acpiphp: Slot [0-15] registered Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.6: PCI bridge to [bus 10] Aug 24 19:45:39 np0000008011 kernel: acpiphp: Slot [0-16] registered Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.7: PCI bridge to [bus 11] Aug 24 19:45:39 np0000008011 kernel: acpiphp: Slot [0-17] registered Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:04.0: PCI bridge to [bus 12] Aug 24 19:45:39 np0000008011 kernel: ACPI: PCI: Interrupt link LNKA configured for IRQ 10 Aug 24 19:45:39 np0000008011 kernel: ACPI: PCI: Interrupt link LNKB configured for IRQ 10 Aug 24 19:45:39 np0000008011 kernel: ACPI: PCI: Interrupt link LNKC configured for IRQ 11 Aug 24 19:45:39 np0000008011 kernel: ACPI: PCI: Interrupt link LNKD configured for IRQ 11 Aug 24 19:45:39 np0000008011 kernel: ACPI: PCI: Interrupt link LNKE configured for IRQ 10 Aug 24 19:45:39 np0000008011 kernel: ACPI: PCI: Interrupt link LNKF configured for IRQ 10 Aug 24 19:45:39 np0000008011 kernel: ACPI: PCI: Interrupt link LNKG configured for IRQ 11 Aug 24 19:45:39 np0000008011 kernel: ACPI: PCI: Interrupt link LNKH configured for IRQ 11 Aug 24 19:45:39 np0000008011 kernel: ACPI: PCI: Interrupt link GSIA configured for IRQ 16 Aug 24 19:45:39 np0000008011 kernel: ACPI: PCI: Interrupt link GSIB configured for IRQ 17 Aug 24 19:45:39 np0000008011 kernel: ACPI: PCI: Interrupt link GSIC configured for IRQ 18 Aug 24 19:45:39 np0000008011 kernel: ACPI: PCI: Interrupt link GSID configured for IRQ 19 Aug 24 19:45:39 np0000008011 kernel: ACPI: PCI: Interrupt link GSIE configured for IRQ 20 Aug 24 19:45:39 np0000008011 kernel: ACPI: PCI: Interrupt link GSIF configured for IRQ 21 Aug 24 19:45:39 np0000008011 kernel: ACPI: PCI: Interrupt link GSIG configured for IRQ 22 Aug 24 19:45:39 np0000008011 kernel: ACPI: PCI: Interrupt link GSIH configured for IRQ 23 Aug 24 19:45:39 np0000008011 kernel: iommu: Default domain type: Translated Aug 24 19:45:39 np0000008011 kernel: iommu: DMA domain TLB invalidation policy: lazy mode Aug 24 19:45:39 np0000008011 kernel: SCSI subsystem initialized Aug 24 19:45:39 np0000008011 kernel: libata version 3.00 loaded. Aug 24 19:45:39 np0000008011 kernel: ACPI: bus type USB registered Aug 24 19:45:39 np0000008011 kernel: usbcore: registered new interface driver usbfs Aug 24 19:45:39 np0000008011 kernel: usbcore: registered new interface driver hub Aug 24 19:45:39 np0000008011 kernel: usbcore: registered new device driver usb Aug 24 19:45:39 np0000008011 kernel: pps_core: LinuxPPS API ver. 1 registered Aug 24 19:45:39 np0000008011 kernel: pps_core: Software ver. 5.3.6 - Copyright 2005-2007 Rodolfo Giometti Aug 24 19:45:39 np0000008011 kernel: PTP clock support registered Aug 24 19:45:39 np0000008011 kernel: EDAC MC: Ver: 3.0.0 Aug 24 19:45:39 np0000008011 kernel: NetLabel: Initializing Aug 24 19:45:39 np0000008011 kernel: NetLabel: domain hash size = 128 Aug 24 19:45:39 np0000008011 kernel: NetLabel: protocols = UNLABELED CIPSOv4 CALIPSO Aug 24 19:45:39 np0000008011 kernel: NetLabel: unlabeled traffic allowed by default Aug 24 19:45:39 np0000008011 kernel: mctp: management component transport protocol core Aug 24 19:45:39 np0000008011 kernel: NET: Registered PF_MCTP protocol family Aug 24 19:45:39 np0000008011 kernel: PCI: Using ACPI for IRQ routing Aug 24 19:45:39 np0000008011 kernel: PCI: pci_cache_line_size set to 64 bytes Aug 24 19:45:39 np0000008011 kernel: e820: reserve RAM buffer [mem 0x0009fc00-0x0009ffff] Aug 24 19:45:39 np0000008011 kernel: e820: reserve RAM buffer [mem 0x7ffdb000-0x7fffffff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:01.0: vgaarb: setting as boot VGA device Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:01.0: vgaarb: bridge control possible Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:01.0: vgaarb: VGA device added: decodes=io+mem,owns=io+mem,locks=none Aug 24 19:45:39 np0000008011 kernel: vgaarb: loaded Aug 24 19:45:39 np0000008011 kernel: clocksource: Switched to clocksource kvm-clock Aug 24 19:45:39 np0000008011 kernel: VFS: Disk quotas dquot_6.6.0 Aug 24 19:45:39 np0000008011 kernel: VFS: Dquot-cache hash table entries: 512 (order 0, 4096 bytes) Aug 24 19:45:39 np0000008011 kernel: AppArmor: AppArmor Filesystem Enabled Aug 24 19:45:39 np0000008011 kernel: pnp: PnP ACPI init Aug 24 19:45:39 np0000008011 kernel: system 00:04: [mem 0xb0000000-0xbfffffff window] has been reserved Aug 24 19:45:39 np0000008011 kernel: pnp: PnP ACPI: found 5 devices Aug 24 19:45:39 np0000008011 kernel: clocksource: acpi_pm: mask: 0xffffff max_cycles: 0xffffff, max_idle_ns: 2085701024 ns Aug 24 19:45:39 np0000008011 kernel: NET: Registered PF_INET protocol family Aug 24 19:45:39 np0000008011 kernel: IP idents hash table entries: 262144 (order: 9, 2097152 bytes, linear) Aug 24 19:45:39 np0000008011 kernel: tcp_listen_portaddr_hash hash table entries: 16384 (order: 6, 262144 bytes, linear) Aug 24 19:45:39 np0000008011 kernel: Table-perturb hash table entries: 65536 (order: 6, 262144 bytes, linear) Aug 24 19:45:39 np0000008011 kernel: TCP established hash table entries: 262144 (order: 9, 2097152 bytes, linear) Aug 24 19:45:39 np0000008011 kernel: TCP bind hash table entries: 65536 (order: 9, 2097152 bytes, linear) Aug 24 19:45:39 np0000008011 kernel: TCP: Hash tables configured (established 262144 bind 65536) Aug 24 19:45:39 np0000008011 kernel: MPTCP token hash table entries: 32768 (order: 8, 786432 bytes, linear) Aug 24 19:45:39 np0000008011 kernel: UDP hash table entries: 16384 (order: 7, 524288 bytes, linear) Aug 24 19:45:39 np0000008011 kernel: UDP-Lite hash table entries: 16384 (order: 7, 524288 bytes, linear) Aug 24 19:45:39 np0000008011 kernel: NET: Registered PF_UNIX/PF_LOCAL protocol family Aug 24 19:45:39 np0000008011 kernel: NET: Registered PF_XDP protocol family Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.1: bridge window [io 0x1000-0x0fff] to [bus 03] add_size 1000 Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.2: bridge window [io 0x1000-0x0fff] to [bus 04] add_size 1000 Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.3: bridge window [io 0x1000-0x0fff] to [bus 05] add_size 1000 Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.4: bridge window [io 0x1000-0x0fff] to [bus 06] add_size 1000 Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.5: bridge window [io 0x1000-0x0fff] to [bus 07] add_size 1000 Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.6: bridge window [io 0x1000-0x0fff] to [bus 08] add_size 1000 Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.7: bridge window [io 0x1000-0x0fff] to [bus 09] add_size 1000 Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.0: bridge window [io 0x1000-0x0fff] to [bus 0a] add_size 1000 Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.1: bridge window [io 0x1000-0x0fff] to [bus 0b] add_size 1000 Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.2: bridge window [io 0x1000-0x0fff] to [bus 0c] add_size 1000 Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.3: bridge window [io 0x1000-0x0fff] to [bus 0d] add_size 1000 Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.4: bridge window [io 0x1000-0x0fff] to [bus 0e] add_size 1000 Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.5: bridge window [io 0x1000-0x0fff] to [bus 0f] add_size 1000 Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.6: bridge window [io 0x1000-0x0fff] to [bus 10] add_size 1000 Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.7: bridge window [io 0x1000-0x0fff] to [bus 11] add_size 1000 Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:04.0: bridge window [io 0x1000-0x0fff] to [bus 12] add_size 1000 Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.1: bridge window [io 0x1000-0x1fff]: assigned Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.2: bridge window [io 0x2000-0x2fff]: assigned Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.3: bridge window [io 0x3000-0x3fff]: assigned Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.4: bridge window [io 0x4000-0x4fff]: assigned Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.5: bridge window [io 0x5000-0x5fff]: assigned Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.6: bridge window [io 0x6000-0x6fff]: assigned Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.7: bridge window [io 0x7000-0x7fff]: assigned Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.0: bridge window [io 0x8000-0x8fff]: assigned Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.1: bridge window [io 0x9000-0x9fff]: assigned Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.2: bridge window [io 0xa000-0xafff]: assigned Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.3: bridge window [io 0xb000-0xbfff]: assigned Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.4: bridge window [io 0xe000-0xefff]: assigned Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.5: bridge window [io 0xf000-0xffff]: assigned Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.6: bridge window [io size 0x1000]: can't assign; no space Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.6: bridge window [io size 0x1000]: failed to assign Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.7: bridge window [io size 0x1000]: can't assign; no space Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.7: bridge window [io size 0x1000]: failed to assign Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:04.0: bridge window [io size 0x1000]: can't assign; no space Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:04.0: bridge window [io size 0x1000]: failed to assign Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:04.0: bridge window [io 0x1000-0x1fff]: assigned Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.7: bridge window [io 0x2000-0x2fff]: assigned Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.6: bridge window [io 0x3000-0x3fff]: assigned Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.5: bridge window [io 0x4000-0x4fff]: assigned Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.4: bridge window [io 0x5000-0x5fff]: assigned Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.3: bridge window [io 0x6000-0x6fff]: assigned Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.2: bridge window [io 0x7000-0x7fff]: assigned Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.1: bridge window [io 0x8000-0x8fff]: assigned Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.0: bridge window [io 0x9000-0x9fff]: assigned Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.7: bridge window [io 0xa000-0xafff]: assigned Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.6: bridge window [io 0xb000-0xbfff]: assigned Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.5: bridge window [io 0xe000-0xefff]: assigned Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.4: bridge window [io 0xf000-0xffff]: assigned Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.3: bridge window [io size 0x1000]: can't assign; no space Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.3: bridge window [io size 0x1000]: failed to assign Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.2: bridge window [io size 0x1000]: can't assign; no space Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.2: bridge window [io size 0x1000]: failed to assign Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.1: bridge window [io size 0x1000]: can't assign; no space Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.1: bridge window [io size 0x1000]: failed to assign Aug 24 19:45:39 np0000008011 kernel: pci 0000:01:00.0: PCI bridge to [bus 02] Aug 24 19:45:39 np0000008011 kernel: pci 0000:01:00.0: bridge window [io 0xc000-0xcfff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:01:00.0: bridge window [mem 0xfc600000-0xfc7fffff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:01:00.0: bridge window [mem 0xc200000000-0xc21fffffff 64bit pref] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.0: PCI bridge to [bus 01-02] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.0: bridge window [io 0xc000-0xcfff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.0: bridge window [mem 0xfc600000-0xfc9fffff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.0: bridge window [mem 0xc200000000-0xc21fffffff 64bit pref] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.1: PCI bridge to [bus 03] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.1: bridge window [mem 0xfe800000-0xfe9fffff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.1: bridge window [mem 0xc1e0000000-0xc1ffffffff 64bit pref] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.2: PCI bridge to [bus 04] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.2: bridge window [mem 0xfe600000-0xfe7fffff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.2: bridge window [mem 0xc1c0000000-0xc1dfffffff 64bit pref] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.3: PCI bridge to [bus 05] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.3: bridge window [mem 0xfe400000-0xfe5fffff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.3: bridge window [mem 0xc1a0000000-0xc1bfffffff 64bit pref] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.4: PCI bridge to [bus 06] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.4: bridge window [io 0xf000-0xffff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.4: bridge window [mem 0xfe200000-0xfe3fffff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.4: bridge window [mem 0xc180000000-0xc19fffffff 64bit pref] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.5: PCI bridge to [bus 07] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.5: bridge window [io 0xe000-0xefff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.5: bridge window [mem 0xfe000000-0xfe1fffff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.5: bridge window [mem 0xc160000000-0xc17fffffff 64bit pref] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.6: PCI bridge to [bus 08] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.6: bridge window [io 0xb000-0xbfff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.6: bridge window [mem 0xfde00000-0xfdffffff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.6: bridge window [mem 0xc140000000-0xc15fffffff 64bit pref] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.7: PCI bridge to [bus 09] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.7: bridge window [io 0xa000-0xafff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.7: bridge window [mem 0xfdc00000-0xfddfffff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:02.7: bridge window [mem 0xc120000000-0xc13fffffff 64bit pref] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.0: PCI bridge to [bus 0a] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.0: bridge window [io 0x9000-0x9fff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.0: bridge window [mem 0xfda00000-0xfdbfffff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.0: bridge window [mem 0xc100000000-0xc11fffffff 64bit pref] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.1: PCI bridge to [bus 0b] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.1: bridge window [io 0x8000-0x8fff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.1: bridge window [mem 0xfd800000-0xfd9fffff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.1: bridge window [mem 0xc0e0000000-0xc0ffffffff 64bit pref] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.2: PCI bridge to [bus 0c] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.2: bridge window [io 0x7000-0x7fff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.2: bridge window [mem 0xfd600000-0xfd7fffff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.2: bridge window [mem 0xc0c0000000-0xc0dfffffff 64bit pref] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.3: PCI bridge to [bus 0d] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.3: bridge window [io 0x6000-0x6fff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.3: bridge window [mem 0xfd400000-0xfd5fffff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.3: bridge window [mem 0xc0a0000000-0xc0bfffffff 64bit pref] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.4: PCI bridge to [bus 0e] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.4: bridge window [io 0x5000-0x5fff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.4: bridge window [mem 0xfd200000-0xfd3fffff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.4: bridge window [mem 0xc080000000-0xc09fffffff 64bit pref] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.5: PCI bridge to [bus 0f] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.5: bridge window [io 0x4000-0x4fff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.5: bridge window [mem 0xfd000000-0xfd1fffff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.5: bridge window [mem 0xc060000000-0xc07fffffff 64bit pref] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.6: PCI bridge to [bus 10] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.6: bridge window [io 0x3000-0x3fff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.6: bridge window [mem 0xfce00000-0xfcffffff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.6: bridge window [mem 0xc040000000-0xc05fffffff 64bit pref] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.7: PCI bridge to [bus 11] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.7: bridge window [io 0x2000-0x2fff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.7: bridge window [mem 0xfcc00000-0xfcdfffff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:03.7: bridge window [mem 0xc020000000-0xc03fffffff 64bit pref] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:04.0: PCI bridge to [bus 12] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:04.0: bridge window [io 0x1000-0x1fff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:04.0: bridge window [mem 0xfca00000-0xfcbfffff] Aug 24 19:45:39 np0000008011 kernel: pci 0000:00:04.0: bridge window [mem 0xc000000000-0xc01fffffff 64bit pref] Aug 24 19:45:39 np0000008011 kernel: pci_bus 0000:00: resource 4 [io 0x0000-0x0cf7 window] Aug 24 19:45:39 np0000008011 kernel: pci_bus 0000:00: resource 5 [io 0x0d00-0xffff window] Aug 24 19:45:39 np0000008011 kernel: pci_bus 0000:00: resource 6 [mem 0x000a0000-0x000bffff window] Aug 24 19:45:39 np0000008011 kernel: pci_bus 0000:00: resource 7 [mem 0x80000000-0xafffffff window] Aug 24 19:45:39 np0000008011 kernel: pci_bus 0000:00: resource 8 [mem 0xc0000000-0xfebfffff window] Aug 24 19:45:39 np0000008011 kernel: pci_bus 0000:00: resource 9 [mem 0xc000000000-0xc7ffffffff window] Aug 24 19:45:39 np0000008011 kernel: pci_bus 0000:01: resource 0 [io 0xc000-0xcfff] Aug 24 19:45:39 np0000008011 kernel: pci_bus 0000:01: resource 1 [mem 0xfc600000-0xfc9fffff] Aug 24 19:45:39 np0000008011 kernel: pci_bus 0000:01: resource 2 [mem 0xc200000000-0xc21fffffff 64bit pref] Aug 24 19:45:39 np0000008011 kernel: pci_bus 0000:02: resource 0 [io 0xc000-0xcfff] Aug 24 19:45:39 np0000008011 kernel: pci_bus 0000:02: resource 1 [mem 0xfc600000-0xfc7fffff] Aug 24 19:45:39 np0000008011 kernel: pci_bus 0000:02: resource 2 [mem 0xc200000000-0xc21fffffff 64bit pref] Aug 24 19:45:39 np0000008011 kernel: pci_bus 0000:03: resource 1 [mem 0xfe800000-0xfe9fffff] Aug 24 19:45:39 np0000008011 kernel: pci_bus 0000:03: resource 2 [mem 0xc1e0000000-0xc1ffffffff 64bit pref] Aug 24 19:45:39 np0000008011 kernel: pci_bus 0000:04: resource 1 [mem 0xfe600000-0xfe7fffff] Aug 24 19:45:39 np0000008011 kernel: pci_bus 0000:04: resource 2 [mem 0xc1c0000000-0xc1dfffffff 64bit pref] Aug 24 19:45:39 np0000008011 kernel: pci_bus 0000:05: resource 1 [mem 0xfe400000-0xfe5fffff] Aug 24 19:45:39 np0000008011 kernel: pci_bus 0000:05: resource 2 [mem 0xc1a0000000-0xc1bfffffff 64bit pref] Aug 24 19:45:39 np0000008011 kernel: pci_bus 0000:06: resource 0 [io 0xf000-0xffff] Aug 24 19:45:39 np0000008011 kernel: pci_bus 0000:06: resource 1 [mem 0xfe200000-0xfe3fffff] Aug 24 19:45:39 np0000008011 kernel: pci_bus 0000:06: resource 2 [mem 0xc180000000-0xc19fffffff 64bit pref] Aug 24 19:45:39 np0000008011 kernel: pci_bus 0000:07: resource 0 [io 0xe000-0xefff] Aug 24 19:45:39 np0000008011 kernel: pci_bus 0000:07: resource 1 [mem 0xfe000000-0xfe1fffff] Aug 24 19:45:39 np0000008011 kernel: pci_bus 0000:07: resource 2 [mem 0xc160000000-0xc17fffffff 64bit pref] Aug 24 19:45:39 np0000008011 kernel: pci_bus 0000:08: resource 0 [io 0xb000-0xbfff] Aug 24 19:45:39 np0000008011 kernel: pci_bus 0000:08: resource 1 [mem 0xfde00000-0xfdffffff] Aug 24 19:45:39 np0000008011 kernel: pci_bus 0000:08: resource 2 [mem 0xc140000000-0xc15fffffff 64bit pref] Aug 24 19:45:39 np0000008011 kernel: pci_bus 0000:09: resource 0 [io 0xa000-0xafff] Aug 24 19:45:39 np0000008011 kernel: pci_bus 0000:09: resource 1 [mem 0xfdc00000-0xfddfffff] Aug 24 19:45:39 np0000008011 kernel: pci_bus 0000:09: resource 2 [mem 0xc120000000-0xc13fffffff 64bit pref] Aug 24 19:45:39 np0000008011 kernel: pci_bus 0000:0a: resource 0 [io 0x9000-0x9fff] Aug 24 19:45:39 np0000008011 kernel: pci_bus 0000:0a: resource 1 [mem 0xfda00000-0xfdbfffff] Aug 24 19:45:39 np0000008011 kernel: pci_bus 0000:0a: resource 2 [mem 0xc100000000-0xc11fffffff 64bit pref] Aug 24 19:45:39 np0000008011 kernel: pci_bus 0000:0b: resource 0 [io 0x8000-0x8fff] Aug 24 19:45:39 np0000008011 kernel: pci_bus 0000:0b: resource 1 [mem 0xfd800000-0xfd9fffff] Aug 24 19:45:39 np0000008011 kernel: pci_bus 0000:0b: resource 2 [mem 0xc0e0000000-0xc0ffffffff 64bit pref] Aug 24 19:45:39 np0000008011 kernel: pci_bus 0000:0c: resource 0 [io 0x7000-0x7fff] Aug 24 19:45:39 np0000008011 kernel: pci_bus 0000:0c: resource 1 [mem 0xfd600000-0xfd7fffff] Aug 24 19:45:39 np0000008011 kernel: pci_bus 0000:0c: resource 2 [mem 0xc0c0000000-0xc0dfffffff 64bit pref] Aug 24 19:45:39 np0000008011 kernel: pci_bus 0000:0d: resource 0 [io 0x6000-0x6fff] Aug 24 19:45:39 np0000008011 kernel: pci_bus 0000:0d: resource 1 [mem 0xfd400000-0xfd5fffff] Aug 24 19:45:39 np0000008011 kernel: pci_bus 0000:0d: resource 2 [mem 0xc0a0000000-0xc0bfffffff 64bit pref] Aug 24 19:45:39 np0000008011 kernel: pci_bus 0000:0e: resource 0 [io 0x5000-0x5fff] Aug 24 19:45:39 np0000008011 kernel: pci_bus 0000:0e: resource 1 [mem 0xfd200000-0xfd3fffff] Aug 24 19:45:39 np0000008011 kernel: pci_bus 0000:0e: resource 2 [mem 0xc080000000-0xc09fffffff 64bit pref] Aug 24 19:45:39 np0000008011 kernel: pci_bus 0000:0f: resource 0 [io 0x4000-0x4fff] Aug 24 19:45:39 np0000008011 kernel: pci_bus 0000:0f: resource 1 [mem 0xfd000000-0xfd1fffff] Aug 24 19:45:39 np0000008011 kernel: pci_bus 0000:0f: resource 2 [mem 0xc060000000-0xc07fffffff 64bit pref] Aug 24 19:45:39 np0000008011 kernel: pci_bus 0000:10: resource 0 [io 0x3000-0x3fff] Aug 24 19:45:39 np0000008011 kernel: pci_bus 0000:10: resource 1 [mem 0xfce00000-0xfcffffff] Aug 24 19:45:39 np0000008011 kernel: pci_bus 0000:10: resource 2 [mem 0xc040000000-0xc05fffffff 64bit pref] Aug 24 19:45:39 np0000008011 kernel: pci_bus 0000:11: resource 0 [io 0x2000-0x2fff] Aug 24 19:45:39 np0000008011 kernel: pci_bus 0000:11: resource 1 [mem 0xfcc00000-0xfcdfffff] Aug 24 19:45:39 np0000008011 kernel: pci_bus 0000:11: resource 2 [mem 0xc020000000-0xc03fffffff 64bit pref] Aug 24 19:45:39 np0000008011 kernel: pci_bus 0000:12: resource 0 [io 0x1000-0x1fff] Aug 24 19:45:39 np0000008011 kernel: pci_bus 0000:12: resource 1 [mem 0xfca00000-0xfcbfffff] Aug 24 19:45:39 np0000008011 kernel: pci_bus 0000:12: resource 2 [mem 0xc000000000-0xc01fffffff 64bit pref] Aug 24 19:45:39 np0000008011 kernel: ACPI: \_SB_.GSIG: Enabled at IRQ 22 Aug 24 19:45:39 np0000008011 kernel: PCI: CLS 0 bytes, default 64 Aug 24 19:45:39 np0000008011 kernel: Trying to unpack rootfs image as initramfs... Aug 24 19:45:39 np0000008011 kernel: PCI-DMA: Using software bounce buffering for IO (SWIOTLB) Aug 24 19:45:39 np0000008011 kernel: software IO TLB: mapped [mem 0x000000007bfdb000-0x000000007ffdb000] (64MB) Aug 24 19:45:39 np0000008011 kernel: Initialise system trusted keyrings Aug 24 19:45:39 np0000008011 kernel: Key type blacklist registered Aug 24 19:45:39 np0000008011 kernel: workingset: timestamp_bits=36 max_order=23 bucket_order=0 Aug 24 19:45:39 np0000008011 kernel: zbud: loaded Aug 24 19:45:39 np0000008011 kernel: squashfs: version 4.0 (2009/01/31) Phillip Lougher Aug 24 19:45:39 np0000008011 kernel: fuse: init (API version 7.39) Aug 24 19:45:39 np0000008011 kernel: integrity: Platform Keyring initialized Aug 24 19:45:39 np0000008011 kernel: integrity: Machine keyring initialized Aug 24 19:45:39 np0000008011 kernel: Key type asymmetric registered Aug 24 19:45:39 np0000008011 kernel: Asymmetric key parser 'x509' registered Aug 24 19:45:39 np0000008011 kernel: Block layer SCSI generic (bsg) driver version 0.4 loaded (major 243) Aug 24 19:45:39 np0000008011 kernel: io scheduler mq-deadline registered Aug 24 19:45:39 np0000008011 kernel: pcieport 0000:00:02.0: PME: Signaling with IRQ 24 Aug 24 19:45:39 np0000008011 kernel: pcieport 0000:00:02.0: AER: enabled with IRQ 24 Aug 24 19:45:39 np0000008011 kernel: pcieport 0000:00:02.1: PME: Signaling with IRQ 25 Aug 24 19:45:39 np0000008011 kernel: pcieport 0000:00:02.1: AER: enabled with IRQ 25 Aug 24 19:45:39 np0000008011 kernel: pcieport 0000:00:02.2: PME: Signaling with IRQ 26 Aug 24 19:45:39 np0000008011 kernel: pcieport 0000:00:02.2: AER: enabled with IRQ 26 Aug 24 19:45:39 np0000008011 kernel: pcieport 0000:00:02.3: PME: Signaling with IRQ 27 Aug 24 19:45:39 np0000008011 kernel: pcieport 0000:00:02.3: AER: enabled with IRQ 27 Aug 24 19:45:39 np0000008011 kernel: pcieport 0000:00:02.4: PME: Signaling with IRQ 28 Aug 24 19:45:39 np0000008011 kernel: pcieport 0000:00:02.4: AER: enabled with IRQ 28 Aug 24 19:45:39 np0000008011 kernel: pcieport 0000:00:02.5: PME: Signaling with IRQ 29 Aug 24 19:45:39 np0000008011 kernel: pcieport 0000:00:02.5: AER: enabled with IRQ 29 Aug 24 19:45:39 np0000008011 kernel: pcieport 0000:00:02.6: PME: Signaling with IRQ 30 Aug 24 19:45:39 np0000008011 kernel: pcieport 0000:00:02.6: AER: enabled with IRQ 30 Aug 24 19:45:39 np0000008011 kernel: pcieport 0000:00:02.7: PME: Signaling with IRQ 31 Aug 24 19:45:39 np0000008011 kernel: pcieport 0000:00:02.7: AER: enabled with IRQ 31 Aug 24 19:45:39 np0000008011 kernel: ACPI: \_SB_.GSIH: Enabled at IRQ 23 Aug 24 19:45:39 np0000008011 kernel: pcieport 0000:00:03.0: PME: Signaling with IRQ 32 Aug 24 19:45:39 np0000008011 kernel: pcieport 0000:00:03.0: AER: enabled with IRQ 32 Aug 24 19:45:39 np0000008011 kernel: pcieport 0000:00:03.1: PME: Signaling with IRQ 33 Aug 24 19:45:39 np0000008011 kernel: pcieport 0000:00:03.1: AER: enabled with IRQ 33 Aug 24 19:45:39 np0000008011 kernel: pcieport 0000:00:03.2: PME: Signaling with IRQ 34 Aug 24 19:45:39 np0000008011 kernel: pcieport 0000:00:03.2: AER: enabled with IRQ 34 Aug 24 19:45:39 np0000008011 kernel: pcieport 0000:00:03.3: PME: Signaling with IRQ 35 Aug 24 19:45:39 np0000008011 kernel: pcieport 0000:00:03.3: AER: enabled with IRQ 35 Aug 24 19:45:39 np0000008011 kernel: pcieport 0000:00:03.4: PME: Signaling with IRQ 36 Aug 24 19:45:39 np0000008011 kernel: pcieport 0000:00:03.4: AER: enabled with IRQ 36 Aug 24 19:45:39 np0000008011 kernel: pcieport 0000:00:03.5: PME: Signaling with IRQ 37 Aug 24 19:45:39 np0000008011 kernel: pcieport 0000:00:03.5: AER: enabled with IRQ 37 Aug 24 19:45:39 np0000008011 kernel: pcieport 0000:00:03.6: PME: Signaling with IRQ 38 Aug 24 19:45:39 np0000008011 kernel: pcieport 0000:00:03.6: AER: enabled with IRQ 38 Aug 24 19:45:39 np0000008011 kernel: Freeing initrd memory: 30328K Aug 24 19:45:39 np0000008011 kernel: pcieport 0000:00:03.7: PME: Signaling with IRQ 39 Aug 24 19:45:39 np0000008011 kernel: pcieport 0000:00:03.7: AER: enabled with IRQ 39 Aug 24 19:45:39 np0000008011 kernel: ACPI: \_SB_.GSIE: Enabled at IRQ 20 Aug 24 19:45:39 np0000008011 kernel: pcieport 0000:00:04.0: PME: Signaling with IRQ 40 Aug 24 19:45:39 np0000008011 kernel: pcieport 0000:00:04.0: AER: enabled with IRQ 40 Aug 24 19:45:39 np0000008011 kernel: shpchp 0000:01:00.0: HPC vendor_id 1b36 device_id e ss_vid 0 ss_did 0 Aug 24 19:45:39 np0000008011 kernel: shpchp 0000:01:00.0: pci_hp_register failed with error -16 Aug 24 19:45:39 np0000008011 kernel: shpchp 0000:01:00.0: Slot initialization failed Aug 24 19:45:39 np0000008011 kernel: shpchp: Standard Hot Plug PCI Controller Driver version: 0.4 Aug 24 19:45:39 np0000008011 kernel: Driver imsttfb not loading because of nomodeset parameter Aug 24 19:45:39 np0000008011 kernel: Driver asiliantfb not loading because of nomodeset parameter Aug 24 19:45:39 np0000008011 kernel: input: Power Button as /devices/LNXSYSTM:00/LNXPWRBN:00/input/input0 Aug 24 19:45:39 np0000008011 kernel: ACPI: button: Power Button [PWRF] Aug 24 19:45:39 np0000008011 kernel: ACPI: \_SB_.GSIF: Enabled at IRQ 21 Aug 24 19:45:39 np0000008011 kernel: Free page reporting enabled Aug 24 19:45:39 np0000008011 kernel: Serial: 8250/16550 driver, 32 ports, IRQ sharing enabled Aug 24 19:45:39 np0000008011 kernel: 00:00: ttyS0 at I/O 0x3f8 (irq = 4, base_baud = 115200) is a 16550A Aug 24 19:45:39 np0000008011 kernel: Linux agpgart interface v0.103 Aug 24 19:45:39 np0000008011 kernel: loop: module loaded Aug 24 19:45:39 np0000008011 kernel: virtio_scsi virtio2: 12/0/0 default/read/poll queues Aug 24 19:45:39 np0000008011 kernel: scsi host0: Virtio SCSI HBA Aug 24 19:45:39 np0000008011 kernel: ACPI: bus type drm_connector registered Aug 24 19:45:39 np0000008011 kernel: tun: Universal TUN/TAP device driver, 1.6 Aug 24 19:45:39 np0000008011 kernel: scsi 0:0:0:0: Direct-Access QEMU QEMU HARDDISK 2.5+ PQ: 0 ANSI: 5 Aug 24 19:45:39 np0000008011 kernel: scsi 0:0:0:1: Direct-Access QEMU QEMU HARDDISK 2.5+ PQ: 0 ANSI: 5 Aug 24 19:45:39 np0000008011 kernel: PPP generic driver version 2.4.2 Aug 24 19:45:39 np0000008011 kernel: uhci_hcd 0000:02:01.0: UHCI Host Controller Aug 24 19:45:39 np0000008011 kernel: uhci_hcd 0000:02:01.0: new USB bus registered, assigned bus number 1 Aug 24 19:45:39 np0000008011 kernel: uhci_hcd 0000:02:01.0: detected 2 ports Aug 24 19:45:39 np0000008011 kernel: uhci_hcd 0000:02:01.0: irq 22, io port 0x0000c000 Aug 24 19:45:39 np0000008011 kernel: usb usb1: New USB device found, idVendor=1d6b, idProduct=0001, bcdDevice= 6.08 Aug 24 19:45:39 np0000008011 kernel: usb usb1: New USB device strings: Mfr=3, Product=2, SerialNumber=1 Aug 24 19:45:39 np0000008011 kernel: usb usb1: Product: UHCI Host Controller Aug 24 19:45:39 np0000008011 kernel: usb usb1: Manufacturer: Linux 6.8.0-138-generic uhci_hcd Aug 24 19:45:39 np0000008011 kernel: usb usb1: SerialNumber: 0000:02:01.0 Aug 24 19:45:39 np0000008011 kernel: hub 1-0:1.0: USB hub found Aug 24 19:45:39 np0000008011 kernel: hub 1-0:1.0: 2 ports detected Aug 24 19:45:39 np0000008011 kernel: i8042: PNP: PS/2 Controller [PNP0303:KBD,PNP0f13:MOU] at 0x60,0x64 irq 1,12 Aug 24 19:45:39 np0000008011 kernel: serio: i8042 KBD port at 0x60,0x64 irq 1 Aug 24 19:45:39 np0000008011 kernel: serio: i8042 AUX port at 0x60,0x64 irq 12 Aug 24 19:45:39 np0000008011 kernel: mousedev: PS/2 mouse device common for all mice Aug 24 19:45:39 np0000008011 kernel: sd 0:0:0:0: Power-on or device reset occurred Aug 24 19:45:39 np0000008011 kernel: sd 0:0:0:0: [sda] 209715200 512-byte logical blocks: (107 GB/100 GiB) Aug 24 19:45:39 np0000008011 kernel: sd 0:0:0:0: Attached scsi generic sg0 type 0 Aug 24 19:45:39 np0000008011 kernel: sd 0:0:0:0: [sda] Write Protect is off Aug 24 19:45:39 np0000008011 kernel: rtc_cmos 00:03: RTC can wake from S4 Aug 24 19:45:39 np0000008011 kernel: input: AT Translated Set 2 keyboard as /devices/platform/i8042/serio0/input/input1 Aug 24 19:45:39 np0000008011 kernel: scsi 0:0:0:1: Attached scsi generic sg1 type 0 Aug 24 19:45:39 np0000008011 kernel: rtc_cmos 00:03: registered as rtc0 Aug 24 19:45:39 np0000008011 kernel: rtc_cmos 00:03: setting system clock to 2026-08-24T19:45:37 UTC (1787600737) Aug 24 19:45:39 np0000008011 kernel: sd 0:0:0:0: [sda] Mode Sense: 63 00 00 08 Aug 24 19:45:39 np0000008011 kernel: rtc_cmos 00:03: alarms up to one day, y3k, 242 bytes nvram Aug 24 19:45:39 np0000008011 kernel: i2c_dev: i2c /dev entries driver Aug 24 19:45:39 np0000008011 kernel: device-mapper: core: CONFIG_IMA_DISABLE_HTABLE is disabled. Duplicate IMA measurements will not be recorded in the IMA log. Aug 24 19:45:39 np0000008011 kernel: device-mapper: uevent: version 1.0.3 Aug 24 19:45:39 np0000008011 kernel: device-mapper: ioctl: 4.48.0-ioctl (2023-03-01) initialised: dm-devel@redhat.com Aug 24 19:45:39 np0000008011 kernel: amd_pstate: the _CPC object is not present in SBIOS or ACPI disabled Aug 24 19:45:39 np0000008011 kernel: sd 0:0:0:1: Power-on or device reset occurred Aug 24 19:45:39 np0000008011 kernel: sd 0:0:0:0: [sda] Write cache: enabled, read cache: enabled, doesn't support DPO or FUA Aug 24 19:45:39 np0000008011 kernel: sd 0:0:0:1: [sdb] 482344960 512-byte logical blocks: (247 GB/230 GiB) Aug 24 19:45:39 np0000008011 kernel: ledtrig-cpu: registered to indicate activity on CPUs Aug 24 19:45:39 np0000008011 kernel: drop_monitor: Initializing network drop monitor service Aug 24 19:45:39 np0000008011 kernel: sd 0:0:0:1: [sdb] Write Protect is off Aug 24 19:45:39 np0000008011 kernel: NET: Registered PF_INET6 protocol family Aug 24 19:45:39 np0000008011 kernel: sda: sda1 sda14 sda15 sda16 Aug 24 19:45:39 np0000008011 kernel: sd 0:0:0:1: [sdb] Mode Sense: 63 00 00 08 Aug 24 19:45:39 np0000008011 kernel: sd 0:0:0:0: [sda] Attached SCSI disk Aug 24 19:45:39 np0000008011 kernel: Segment Routing with IPv6 Aug 24 19:45:39 np0000008011 kernel: sd 0:0:0:1: [sdb] Write cache: enabled, read cache: enabled, doesn't support DPO or FUA Aug 24 19:45:39 np0000008011 kernel: In-situ OAM (IOAM) with IPv6 Aug 24 19:45:39 np0000008011 kernel: sd 0:0:0:1: [sdb] Attached SCSI disk Aug 24 19:45:39 np0000008011 kernel: NET: Registered PF_PACKET protocol family Aug 24 19:45:39 np0000008011 kernel: Key type dns_resolver registered Aug 24 19:45:39 np0000008011 kernel: IPI shorthand broadcast: enabled Aug 24 19:45:39 np0000008011 kernel: sched_clock: Marking stable (1138004373, 80845980)->(1284261065, -65410712) Aug 24 19:45:39 np0000008011 kernel: registered taskstats version 1 Aug 24 19:45:39 np0000008011 kernel: Loading compiled-in X.509 certificates Aug 24 19:45:39 np0000008011 kernel: Loaded X.509 cert 'Build time autogenerated kernel key: fee4cdd6bab323197aba707e784856bb231f6106' Aug 24 19:45:39 np0000008011 kernel: Loaded X.509 cert 'Canonical Ltd. Live Patch Signing 2025 Kmod: d541cef61dc7e793b7eb7e899970a2eef0b5dc8c' Aug 24 19:45:39 np0000008011 kernel: Loaded X.509 cert 'Canonical Ltd. Live Patch Signing: 14df34d1a87cf37625abec039ef2bf521249b969' Aug 24 19:45:39 np0000008011 kernel: Loaded X.509 cert 'Canonical Ltd. Kernel Module Signing 2025 Kmod: 4627603d2357a2a3f81006370894c221175893e9' Aug 24 19:45:39 np0000008011 kernel: Loaded X.509 cert 'Canonical Ltd. Kernel Module Signing: 88f752e560a1e0737e31163a466ad7b70a850c19' Aug 24 19:45:39 np0000008011 kernel: blacklist: Loading compiled-in revocation X.509 certificates Aug 24 19:45:39 np0000008011 kernel: Loaded X.509 cert 'Canonical Ltd. Secure Boot Signing: 61482aa2830d0ab2ad5af10b7250da9033ddcef0' Aug 24 19:45:39 np0000008011 kernel: Loaded X.509 cert 'Canonical Ltd. Secure Boot Signing (2017): 242ade75ac4a15e50d50c84b0d45ff3eae707a03' Aug 24 19:45:39 np0000008011 kernel: Loaded X.509 cert 'Canonical Ltd. Secure Boot Signing (ESM 2018): 365188c1d374d6b07c3c8f240f8ef722433d6a8b' Aug 24 19:45:39 np0000008011 kernel: Loaded X.509 cert 'Canonical Ltd. Secure Boot Signing (2019): c0746fd6c5da3ae827864651ad66ae47fe24b3e8' Aug 24 19:45:39 np0000008011 kernel: Loaded X.509 cert 'Canonical Ltd. Secure Boot Signing (2021 v1): a8d54bbb3825cfb94fa13c9f8a594a195c107b8d' Aug 24 19:45:39 np0000008011 kernel: Loaded X.509 cert 'Canonical Ltd. Secure Boot Signing (2021 v2): 4cf046892d6fd3c9a5b03f98d845f90851dc6a8c' Aug 24 19:45:39 np0000008011 kernel: Loaded X.509 cert 'Canonical Ltd. Secure Boot Signing (2021 v3): 100437bb6de6e469b581e61cd66bce3ef4ed53af' Aug 24 19:45:39 np0000008011 kernel: Loaded X.509 cert 'Canonical Ltd. Secure Boot Signing (Ubuntu Core 2019): c1d57b8f6b743f23ee41f4f7ee292f06eecadfb9' Aug 24 19:45:39 np0000008011 kernel: Key type .fscrypt registered Aug 24 19:45:39 np0000008011 kernel: Key type fscrypt-provisioning registered Aug 24 19:45:39 np0000008011 kernel: cryptd: max_cpu_qlen set to 1000 Aug 24 19:45:39 np0000008011 kernel: AVX2 version of gcm_enc/dec engaged. Aug 24 19:45:39 np0000008011 kernel: AES CTR mode by8 optimization enabled Aug 24 19:45:39 np0000008011 kernel: Key type encrypted registered Aug 24 19:45:39 np0000008011 kernel: AppArmor: AppArmor sha256 policy hashing enabled Aug 24 19:45:39 np0000008011 kernel: ima: No TPM chip found, activating TPM-bypass! Aug 24 19:45:39 np0000008011 kernel: Loading compiled-in module X.509 certificates Aug 24 19:45:39 np0000008011 kernel: Loaded X.509 cert 'Build time autogenerated kernel key: fee4cdd6bab323197aba707e784856bb231f6106' Aug 24 19:45:39 np0000008011 kernel: ima: Allocated hash algorithm: sha256 Aug 24 19:45:39 np0000008011 kernel: ima: No architecture policies found Aug 24 19:45:39 np0000008011 kernel: evm: Initialising EVM extended attributes: Aug 24 19:45:39 np0000008011 kernel: evm: security.selinux Aug 24 19:45:39 np0000008011 kernel: evm: security.SMACK64 Aug 24 19:45:39 np0000008011 kernel: evm: security.SMACK64EXEC Aug 24 19:45:39 np0000008011 kernel: evm: security.SMACK64TRANSMUTE Aug 24 19:45:39 np0000008011 kernel: evm: security.SMACK64MMAP Aug 24 19:45:39 np0000008011 kernel: evm: security.apparmor Aug 24 19:45:39 np0000008011 kernel: evm: security.ima Aug 24 19:45:39 np0000008011 kernel: evm: security.capability Aug 24 19:45:39 np0000008011 kernel: evm: HMAC attrs: 0x1 Aug 24 19:45:39 np0000008011 kernel: PM: Magic number: 6:70:800 Aug 24 19:45:39 np0000008011 kernel: RAS: Correctable Errors collector initialized. Aug 24 19:45:39 np0000008011 kernel: clk: Disabling unused clocks Aug 24 19:45:39 np0000008011 kernel: Freeing unused decrypted memory: 2028K Aug 24 19:45:39 np0000008011 kernel: Freeing unused kernel image (initmem) memory: 4932K Aug 24 19:45:39 np0000008011 kernel: Write protecting the kernel read-only data: 38912k Aug 24 19:45:39 np0000008011 kernel: Freeing unused kernel image (rodata/data gap) memory: 1956K Aug 24 19:45:39 np0000008011 kernel: x86/mm: Checked W+X mappings: passed, no W+X pages found. Aug 24 19:45:39 np0000008011 kernel: Run /init as init process Aug 24 19:45:39 np0000008011 kernel: with arguments: Aug 24 19:45:39 np0000008011 kernel: /init Aug 24 19:45:39 np0000008011 kernel: nofb Aug 24 19:45:39 np0000008011 kernel: with environment: Aug 24 19:45:39 np0000008011 kernel: HOME=/ Aug 24 19:45:39 np0000008011 kernel: TERM=linux Aug 24 19:45:39 np0000008011 kernel: vga=normal Aug 24 19:45:39 np0000008011 kernel: usb 1-1: new full-speed USB device number 2 using uhci_hcd Aug 24 19:45:39 np0000008011 kernel: virtio_gpu: probe of virtio0 failed with error -22 Aug 24 19:45:39 np0000008011 kernel: virtio_net virtio5 enp7s0: renamed from eth1 Aug 24 19:45:39 np0000008011 kernel: ahci 0000:00:1f.2: version 3.0 Aug 24 19:45:39 np0000008011 kernel: ACPI: \_SB_.GSIA: Enabled at IRQ 16 Aug 24 19:45:39 np0000008011 kernel: virtio_net virtio1 enp3s0: renamed from eth0 Aug 24 19:45:39 np0000008011 kernel: ahci 0000:00:1f.2: AHCI 0001.0000 32 slots 6 ports 1.5 Gbps 0x3f impl SATA mode Aug 24 19:45:39 np0000008011 kernel: ahci 0000:00:1f.2: flags: 64bit ncq only Aug 24 19:45:39 np0000008011 kernel: usb 1-1: New USB device found, idVendor=0627, idProduct=0001, bcdDevice= 0.00 Aug 24 19:45:39 np0000008011 kernel: usb 1-1: New USB device strings: Mfr=1, Product=3, SerialNumber=10 Aug 24 19:45:39 np0000008011 kernel: usb 1-1: Product: QEMU USB Tablet Aug 24 19:45:39 np0000008011 kernel: usb 1-1: Manufacturer: QEMU Aug 24 19:45:39 np0000008011 kernel: usb 1-1: SerialNumber: 28754-0000:00:02.0:00.0:01.0-1 Aug 24 19:45:39 np0000008011 kernel: virtio_net virtio8 enp10s0: renamed from eth4 Aug 24 19:45:39 np0000008011 kernel: input: VirtualPS/2 VMware VMMouse as /devices/platform/i8042/serio1/input/input4 Aug 24 19:45:39 np0000008011 kernel: scsi host1: ahci Aug 24 19:45:39 np0000008011 kernel: input: VirtualPS/2 VMware VMMouse as /devices/platform/i8042/serio1/input/input3 Aug 24 19:45:39 np0000008011 kernel: virtio_net virtio7 enp9s0: renamed from eth3 Aug 24 19:45:39 np0000008011 kernel: scsi host2: ahci Aug 24 19:45:39 np0000008011 kernel: scsi host3: ahci Aug 24 19:45:39 np0000008011 kernel: scsi host4: ahci Aug 24 19:45:39 np0000008011 kernel: scsi host5: ahci Aug 24 19:45:39 np0000008011 kernel: scsi host6: ahci Aug 24 19:45:39 np0000008011 kernel: hid: raw HID events driver (C) Jiri Kosina Aug 24 19:45:39 np0000008011 kernel: ata1: SATA max UDMA/133 abar m4096@0xfea22000 port 0xfea22100 irq 76 lpm-pol 0 Aug 24 19:45:39 np0000008011 kernel: ata2: SATA max UDMA/133 abar m4096@0xfea22000 port 0xfea22180 irq 76 lpm-pol 0 Aug 24 19:45:39 np0000008011 kernel: virtio_net virtio6 enp8s0: renamed from eth2 Aug 24 19:45:39 np0000008011 kernel: ata3: SATA max UDMA/133 abar m4096@0xfea22000 port 0xfea22200 irq 76 lpm-pol 0 Aug 24 19:45:39 np0000008011 kernel: ata4: SATA max UDMA/133 abar m4096@0xfea22000 port 0xfea22280 irq 76 lpm-pol 0 Aug 24 19:45:39 np0000008011 kernel: ata5: SATA max UDMA/133 abar m4096@0xfea22000 port 0xfea22300 irq 76 lpm-pol 0 Aug 24 19:45:39 np0000008011 kernel: ata6: SATA max UDMA/133 abar m4096@0xfea22000 port 0xfea22380 irq 76 lpm-pol 0 Aug 24 19:45:39 np0000008011 kernel: usbcore: registered new interface driver usbhid Aug 24 19:45:39 np0000008011 kernel: usbhid: USB HID core driver Aug 24 19:45:39 np0000008011 kernel: virtio_net virtio9 enp11s0: renamed from eth5 Aug 24 19:45:39 np0000008011 kernel: ata6: SATA link down (SStatus 0 SControl 300) Aug 24 19:45:39 np0000008011 kernel: ata1: SATA link down (SStatus 0 SControl 300) Aug 24 19:45:39 np0000008011 kernel: ata4: SATA link down (SStatus 0 SControl 300) Aug 24 19:45:39 np0000008011 kernel: ata5: SATA link down (SStatus 0 SControl 300) Aug 24 19:45:39 np0000008011 kernel: ata2: SATA link down (SStatus 0 SControl 300) Aug 24 19:45:39 np0000008011 kernel: ata3: SATA link down (SStatus 0 SControl 300) Aug 24 19:45:39 np0000008011 kernel: input: QEMU QEMU USB Tablet as /devices/pci0000:00/0000:00:02.0/0000:01:00.0/0000:02:01.0/usb1/1-1/1-1:1.0/0003:0627:0001.0001/input/input5 Aug 24 19:45:39 np0000008011 kernel: hid-generic 0003:0627:0001.0001: input,hidraw0: USB HID v0.01 Mouse [QEMU QEMU USB Tablet] on usb-0000:02:01.0-1/input0 Aug 24 19:45:39 np0000008011 kernel: raid6: avx2x4 gen() 27512 MB/s Aug 24 19:45:39 np0000008011 kernel: raid6: avx2x2 gen() 25062 MB/s Aug 24 19:45:39 np0000008011 kernel: raid6: avx2x1 gen() 14784 MB/s Aug 24 19:45:39 np0000008011 kernel: raid6: using algorithm avx2x4 gen() 27512 MB/s Aug 24 19:45:39 np0000008011 kernel: raid6: .... xor() 5321 MB/s, rmw enabled Aug 24 19:45:39 np0000008011 kernel: raid6: using avx2x2 recovery algorithm Aug 24 19:45:39 np0000008011 kernel: xor: automatically using best checksumming function avx Aug 24 19:45:39 np0000008011 kernel: async_tx: api initialized (async) Aug 24 19:45:39 np0000008011 kernel: Btrfs loaded, zoned=yes, fsverity=yes Aug 24 19:45:39 np0000008011 kernel: EXT4-fs (sda1): mounted filesystem 8515de1c-ba7e-467b-adde-6d9f8a8dbc1f ro with ordered data mode. Quota mode: none. Aug 24 19:45:39 np0000008011 kernel: Cgroup memory moving (move_charge_at_immigrate) is deprecated. Please report your usecase to linux-mm@kvack.org if you depend on this functionality. Aug 24 19:45:39 np0000008011 kernel: Key type psk registered Aug 24 19:45:39 np0000008011 kernel: EXT4-fs (sda1): re-mounted 8515de1c-ba7e-467b-adde-6d9f8a8dbc1f r/w. Aug 24 19:45:39 np0000008011 kernel: storpool_rdma: loading out-of-tree module taints kernel. Aug 24 19:45:39 np0000008011 kernel: storpool_rdma: module verification failed: signature and/or required key missing - tainting kernel Aug 24 19:45:39 np0000008011 kernel: storpool_rdma: timeInit: tscPerUsec: 2395 Aug 24 19:45:39 np0000008011 kernel: virtio_net virtio6 iscsi1: renamed from enp8s0 Aug 24 19:45:39 np0000008011 kernel: virtio_net virtio5 iscsi0: renamed from enp7s0 Aug 24 19:45:39 np0000008011 kernel: virtio_net virtio8 sp0: renamed from enp10s0 Aug 24 19:45:39 np0000008011 kernel: virtio_net virtio7 sp-api: renamed from enp9s0 Aug 24 19:45:39 np0000008011 kernel: virtio_net virtio9 sp1: renamed from enp11s0 Aug 24 19:45:39 np0000008011 kernel: EXT4-fs (sda16): mounted filesystem 7dc15ce9-d090-44d7-bb05-2a36d545a8e3 r/w with ordered data mode. Quota mode: none. Aug 24 19:45:39 np0000008011 kernel: kvm_amd: TSC scaling supported Aug 24 19:45:39 np0000008011 kernel: kvm_amd: Nested Virtualization enabled Aug 24 19:45:39 np0000008011 kernel: kvm_amd: Nested Paging enabled Aug 24 19:45:39 np0000008011 kernel: kvm_amd: LBR virtualization supported Aug 24 19:45:39 np0000008011 kernel: kvm_amd: Virtual VMLOAD VMSAVE supported Aug 24 19:45:39 np0000008011 kernel: kvm_amd: Virtual GIF supported Aug 24 19:45:39 np0000008011 kernel: audit: type=1400 audit(1787600739.865:2): apparmor="STATUS" operation="profile_load" profile="unconfined" name="busybox" pid=1088 comm="apparmor_parser" Aug 24 19:45:39 np0000008011 kernel: audit: type=1400 audit(1787600739.865:3): apparmor="STATUS" operation="profile_load" profile="unconfined" name="Discord" pid=1082 comm="apparmor_parser" Aug 24 19:45:39 np0000008011 kernel: audit: type=1400 audit(1787600739.865:4): apparmor="STATUS" operation="profile_load" profile="unconfined" name="balena-etcher" pid=1085 comm="apparmor_parser" Aug 24 19:45:39 np0000008011 kernel: audit: type=1400 audit(1787600739.865:5): apparmor="STATUS" operation="profile_load" profile="unconfined" name="ch-checkns" pid=1090 comm="apparmor_parser" Aug 24 19:45:39 np0000008011 kernel: audit: type=1400 audit(1787600739.865:6): apparmor="STATUS" operation="profile_load" profile="unconfined" name="buildah" pid=1087 comm="apparmor_parser" Aug 24 19:45:39 np0000008011 kernel: audit: type=1400 audit(1787600739.865:7): apparmor="STATUS" operation="profile_load" profile="unconfined" name="chrome" pid=1092 comm="apparmor_parser" Aug 24 19:45:39 np0000008011 kernel: audit: type=1400 audit(1787600739.865:8): apparmor="STATUS" operation="profile_load" profile="unconfined" name="brave" pid=1086 comm="apparmor_parser" Aug 24 19:45:39 np0000008011 kernel: audit: type=1400 audit(1787600739.865:9): apparmor="STATUS" operation="profile_load" profile="unconfined" name="QtWebEngineProcess" pid=1084 comm="apparmor_parser" Aug 24 19:45:39 np0000008011 kernel: audit: type=1400 audit(1787600739.865:10): apparmor="STATUS" operation="profile_load" profile="unconfined" name="cam" pid=1089 comm="apparmor_parser" Aug 24 19:45:44 np0000008011 kernel: kauditd_printk_skb: 112 callbacks suppressed Aug 24 19:45:44 np0000008011 kernel: audit: type=1400 audit(1787600744.923:123): apparmor="STATUS" operation="profile_replace" info="same as current profile, skipping" profile="unconfined" name="rsyslogd" pid=4948 comm="apparmor_parser" Aug 24 19:45:45 np0000008011 kernel: loop0: detected capacity change from 0 to 8 Aug 24 19:45:45 np0000008011 kernel: audit: type=1400 audit(1787600745.206:124): apparmor="STATUS" operation="profile_replace" profile="unconfined" name="/usr/lib/snapd/snap-confine" pid=5139 comm="apparmor_parser" Aug 24 19:45:45 np0000008011 kernel: audit: type=1400 audit(1787600745.217:125): apparmor="STATUS" operation="profile_replace" profile="unconfined" name="/usr/lib/snapd/snap-confine//mount-namespace-capture-helper" pid=5139 comm="apparmor_parser" Aug 24 19:46:31 np0000008011 sudo[5344]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-gzikylsdtvswnoerqmqabxabtrhhlano ; cat /proc/sys/kernel/random/boot_id' Aug 24 19:46:31 np0000008011 sudo[5344]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:46:31 np0000008011 sudo[5344]: pam_unix(sudo:session): session closed for user root Aug 24 19:46:31 np0000008011 sudo[5349]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-tlheyfqmqxmgukvifircchrrgyzdezgt ; whoami' Aug 24 19:46:31 np0000008011 sudo[5349]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:46:31 np0000008011 sudo[5349]: pam_unix(sudo:session): session closed for user root Aug 24 19:46:40 np0000008011 sudo[6186]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-kjczsfnxgkypblktbczyczkjvbykmnng ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600799.9169114-10797-270380490328698/AnsiballZ_ufw.py' Aug 24 19:46:40 np0000008011 sudo[6186]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:46:40 np0000008011 sudo[6186]: pam_unix(sudo:session): session closed for user root Aug 24 19:46:40 np0000008011 sudo[6230]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-xhaxgmgjyfdodohhrzcwawmsjaeseyjt ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600800.7935734-10797-179792397746049/AnsiballZ_ufw.py' Aug 24 19:46:40 np0000008011 sudo[6230]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:46:41 np0000008011 sudo[6230]: pam_unix(sudo:session): session closed for user root Aug 24 19:46:41 np0000008011 sudo[6269]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-hfuotppqmsqdmqbhaizjuualrveobrqt ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600801.4692166-10797-160675566578606/AnsiballZ_ufw.py' Aug 24 19:46:41 np0000008011 sudo[6269]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:46:42 np0000008011 sudo[6269]: pam_unix(sudo:session): session closed for user root Aug 24 19:46:42 np0000008011 sudo[6389]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-szbwuacdixaizpugpwdhicgopvjhedwd ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600802.8844345-10827-23054999295558/AnsiballZ_command.py' Aug 24 19:46:42 np0000008011 sudo[6389]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:46:43 np0000008011 sudo[6389]: pam_unix(sudo:session): session closed for user root Aug 24 19:46:43 np0000008011 sudo[6412]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-ipmdnavjnkwjfelpxkxzuxofreokccdr ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600803.7412262-10840-122239418521538/AnsiballZ_command.py' Aug 24 19:46:43 np0000008011 sudo[6412]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:46:44 np0000008011 sudo[6412]: pam_unix(sudo:session): session closed for user root Aug 24 19:46:44 np0000008011 sudo[6444]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-ycoakeevkxefpjtsqewrdlynwxyceohw ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600804.6648233-10849-260632048409543/AnsiballZ_service_facts.py' Aug 24 19:46:44 np0000008011 sudo[6444]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:46:48 np0000008011 sudo[6444]: pam_unix(sudo:session): session closed for user root Aug 24 19:46:49 np0000008011 sudo[7046]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-qepixerfkvlpdiurblnbnltknwqqshfq ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600809.0849352-10867-122451653270927/AnsiballZ_file.py' Aug 24 19:46:49 np0000008011 sudo[7046]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:46:49 np0000008011 sudo[7046]: pam_unix(sudo:session): session closed for user root Aug 24 19:46:49 np0000008011 sudo[7064]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-zdchfvwtsmlqybyuzmvyvvupfunxjgco ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600809.4886553-10875-121956920344051/AnsiballZ_systemd.py' Aug 24 19:46:49 np0000008011 sudo[7064]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:46:49 np0000008011 sudo[7064]: pam_unix(sudo:session): session closed for user root Aug 24 19:46:50 np0000008011 sudo[7083]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-ozaicmwgyqqlgvwqyhdipmstdselnpge ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600810.0652616-10884-117381755688985/AnsiballZ_command.py' Aug 24 19:46:50 np0000008011 sudo[7083]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:46:50 np0000008011 sudo[7083]: pam_unix(sudo:session): session closed for user root Aug 24 19:46:50 np0000008011 sudo[7106]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-spmncfxlufrxsqftwwawvmqqxddyzuqv ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600810.6433687-10893-220212072785450/AnsiballZ_stat.py' Aug 24 19:46:50 np0000008011 sudo[7106]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:46:50 np0000008011 sudo[7106]: pam_unix(sudo:session): session closed for user root Aug 24 19:46:51 np0000008011 sudo[7117]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-awnuwlbqgvhsnsbzhbsmlujlrlwatwjw ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600810.6433687-10893-220212072785450/AnsiballZ_copy.py' Aug 24 19:46:51 np0000008011 sudo[7117]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:46:51 np0000008011 sudo[7117]: pam_unix(sudo:session): session closed for user root Aug 24 19:46:51 np0000008011 sudo[7135]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-mxujxiyxefupvwsljqsthgdailablttj ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600811.390407-10908-222525712086400/AnsiballZ_copy.py' Aug 24 19:46:51 np0000008011 sudo[7135]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:46:51 np0000008011 sudo[7135]: pam_unix(sudo:session): session closed for user root Aug 24 19:46:52 np0000008011 sudo[7176]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-ouaribglizibidghpbrhvxchxfuqegcm ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600812.422218-10931-130548535242249/AnsiballZ_slurp.py' Aug 24 19:46:52 np0000008011 sudo[7176]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:46:52 np0000008011 sudo[7176]: pam_unix(sudo:session): session closed for user root Aug 24 19:46:53 np0000008011 sudo[7194]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-chhatdbdkqbselrxdletzavrpvxtypdw ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600813.0416796-10942-83088562243296/AnsiballZ_command.py' Aug 24 19:46:53 np0000008011 sudo[7194]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:46:53 np0000008011 kernel: sdb: sdb1 Aug 24 19:46:56 np0000008011 sudo[7194]: pam_unix(sudo:session): session closed for user root Aug 24 19:46:56 np0000008011 sudo[7262]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-sptosupiuvyheefxmkzhbeiheuiueygn ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600816.6939213-10950-112614694836622/AnsiballZ_systemd.py' Aug 24 19:46:56 np0000008011 sudo[7262]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:46:57 np0000008011 sudo[7262]: pam_unix(sudo:session): session closed for user root Aug 24 19:46:57 np0000008011 sudo[7296]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-bpgwqinqsbfquqfojjucjiexicdhopya ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600817.3317618-10959-141971116747661/AnsiballZ_stat.py' Aug 24 19:46:57 np0000008011 sudo[7296]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:46:57 np0000008011 sudo[7296]: pam_unix(sudo:session): session closed for user root Aug 24 19:46:57 np0000008011 sudo[7307]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-cbkdzlnufdqlhbchviwajkuvgqtndxlg ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600817.3317618-10959-141971116747661/AnsiballZ_copy.py' Aug 24 19:46:57 np0000008011 sudo[7307]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:46:57 np0000008011 sudo[7307]: pam_unix(sudo:session): session closed for user root Aug 24 19:46:58 np0000008011 sudo[7325]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-xcfvbcezwzfmolergjqoqdwmbpqsuztg ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600818.014662-10976-194615991947571/AnsiballZ_stat.py' Aug 24 19:46:58 np0000008011 sudo[7325]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:46:58 np0000008011 sudo[7325]: pam_unix(sudo:session): session closed for user root Aug 24 19:46:58 np0000008011 sudo[7360]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-vfwjjcgcmbojorbuigecchszvsdwqnrt ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600818.7911963-10994-236601561418573/AnsiballZ_command.py' Aug 24 19:46:58 np0000008011 sudo[7360]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:46:59 np0000008011 sudo[7360]: pam_unix(sudo:session): session closed for user root Aug 24 19:46:59 np0000008011 sudo[7383]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-pwplqnosnufyjvvkwjuvipsregxguuwe ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600819.2899492-11005-162072613879174/AnsiballZ_command.py' Aug 24 19:46:59 np0000008011 sudo[7383]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:47:02 np0000008011 sudo[7383]: pam_unix(sudo:session): session closed for user root Aug 24 19:47:02 np0000008011 sudo[7413]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-gmjndxgkltyvqfnfvcftjlcpggynlogx ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600822.9119437-11014-69348204647632/AnsiballZ_systemd.py' Aug 24 19:47:02 np0000008011 sudo[7413]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:47:04 np0000008011 sudo[7413]: pam_unix(sudo:session): session closed for user root Aug 24 19:47:04 np0000008011 sudo[7433]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-nahbssktudgcgbicixahjsvhqncfyhlc ; CGCONFIG_FORCE_STARTUP=1 /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600824.5179715-11025-46178167441452/AnsiballZ_command.py' Aug 24 19:47:04 np0000008011 sudo[7433]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:47:04 np0000008011 sudo[7433]: pam_unix(sudo:session): session closed for user root Aug 24 19:47:07 np0000008011 sudo[7659]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-clkpxnwzocuvbphvsolqyfosyswxkiih ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600827.1153731-11059-83592647803854/AnsiballZ_command.py' Aug 24 19:47:07 np0000008011 sudo[7659]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:47:07 np0000008011 sudo[7659]: pam_unix(sudo:session): session closed for user root Aug 24 19:47:07 np0000008011 sudo[7684]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-ucgeqhjfvhovvstbyajlkjysslhrjgfh ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600827.735039-11067-35597556766131/AnsiballZ_command.py' Aug 24 19:47:07 np0000008011 sudo[7684]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:47:09 np0000008011 sudo[7684]: pam_unix(sudo:session): session closed for user root Aug 24 19:47:09 np0000008011 sudo[7842]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-mrrpzeozwfxtkucuwxvhgeidfgjvvcol ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1787600829.1475132-11075-188803258359842/AnsiballZ_command.py' Aug 24 19:47:09 np0000008011 sudo[7842]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:47:11 np0000008011 kernel: storpool_bd: timeInit: tscPerUsec: 2395 Aug 24 19:47:11 np0000008011 kernel: storpool_pci 0000:07:00.0: probing Aug 24 19:47:11 np0000008011 kernel: storpool_pci 0000:07:00.0: device registered, physDev 0000:07:00.0 Aug 24 19:47:11 np0000008011 kernel: storpool_pci 0000:08:00.0: probing Aug 24 19:47:11 np0000008011 kernel: storpool_pci 0000:08:00.0: device registered, physDev 0000:08:00.0 Aug 24 19:47:12 np0000008011 sudo[7842]: pam_unix(sudo:session): session closed for user root Aug 24 19:47:12 np0000008011 kernel: block sdb: the capability attribute has been deprecated. Aug 24 19:47:12 np0000008011 kernel: storpool_disk: closeDisk: service 8137: disk sda closed Aug 24 19:47:14 np0000008011 sudo[8536]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-nqimmhtbsqvzngdhplgkbqrvxitaowkr ; /usr/bin/python3' Aug 24 19:47:14 np0000008011 sudo[8536]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:47:14 np0000008011 sudo[8536]: pam_unix(sudo:session): session closed for user root Aug 24 19:47:15 np0000008011 sudo[8603]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-lerlmqrbbemqiqmmnlbtsxhunmnxmyjl ; /usr/bin/python3' Aug 24 19:47:15 np0000008011 sudo[8603]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:47:15 np0000008011 sudo[8603]: pam_unix(sudo:session): session closed for user root Aug 24 19:47:15 np0000008011 kernel: virtio_net virtio7 sp-api: entered promiscuous mode Aug 24 19:47:15 np0000008011 kernel: virtio_net virtio7 sp-api: left promiscuous mode Aug 24 19:47:15 np0000008011 kernel: virtio_net virtio7 sp-api: entered promiscuous mode Aug 24 19:47:15 np0000008011 kernel: virtio_net virtio7 sp-api: left promiscuous mode Aug 24 19:47:16 np0000008011 kernel: virtio_net virtio7 sp-api: entered promiscuous mode Aug 24 19:47:16 np0000008011 kernel: virtio_net virtio7 sp-api: left promiscuous mode Aug 24 19:47:16 np0000008011 kernel: virtio_net virtio7 sp-api: entered promiscuous mode Aug 24 19:47:16 np0000008011 kernel: virtio_net virtio7 sp-api: left promiscuous mode Aug 24 19:47:16 np0000008011 kernel: virtio_net virtio7 sp-api: entered promiscuous mode Aug 24 19:47:16 np0000008011 kernel: virtio_net virtio7 sp-api: left promiscuous mode Aug 24 19:47:16 np0000008011 kernel: virtio_net virtio7 sp-api: entered promiscuous mode Aug 24 19:47:16 np0000008011 kernel: virtio_net virtio7 sp-api: left promiscuous mode Aug 24 19:47:16 np0000008011 sudo[8624]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-mlnoydnhufjhagajlzawynvuqudewbem ; /usr/bin/python3' Aug 24 19:47:16 np0000008011 sudo[8624]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:47:17 np0000008011 sudo[8624]: pam_unix(sudo:session): session closed for user root Aug 24 19:47:17 np0000008011 sudo[8641]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-xlgjpqdvxeclpehzbvoubwivrdvhmxjw ; /usr/bin/python3' Aug 24 19:47:17 np0000008011 sudo[8641]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:47:17 np0000008011 sudo[8641]: pam_unix(sudo:session): session closed for user root Aug 24 19:47:17 np0000008011 sudo[8670]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-mfwblfnmqsizokmdvdfelvplptqmbfbv ; /usr/bin/python3' Aug 24 19:47:17 np0000008011 sudo[8670]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:47:18 np0000008011 sudo[8670]: pam_unix(sudo:session): session closed for user root Aug 24 19:47:18 np0000008011 sudo[8682]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-rcyxsdbxkujjnvntdderltzimxeodlru ; /usr/bin/python3' Aug 24 19:47:18 np0000008011 sudo[8682]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:47:18 np0000008011 sudo[8682]: pam_unix(sudo:session): session closed for user root Aug 24 19:47:18 np0000008011 sudo[8710]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-ydjdrysrvsrlgfjokmmkrzzyqspdmlnu ; /usr/bin/python3' Aug 24 19:47:18 np0000008011 sudo[8710]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:47:18 np0000008011 sudo[8710]: pam_unix(sudo:session): session closed for user root Aug 24 19:47:18 np0000008011 sudo[8723]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-odklcvpuindmypeqnnigyfddmwetabie ; /usr/bin/python3' Aug 24 19:47:18 np0000008011 sudo[8723]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:47:19 np0000008011 sudo[8723]: pam_unix(sudo:session): session closed for user root Aug 24 19:47:19 np0000008011 sudo[8735]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-eogokxizmxcijkbigcflifhhobxertcl ; /usr/bin/python3' Aug 24 19:47:19 np0000008011 sudo[8735]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:47:19 np0000008011 sudo[8735]: pam_unix(sudo:session): session closed for user root Aug 24 19:47:19 np0000008011 sudo[8762]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-rqiawovxjudwcmjqbofjjbpyqmqzpwco ; /usr/bin/python3' Aug 24 19:47:19 np0000008011 sudo[8762]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:47:19 np0000008011 sudo[8762]: pam_unix(sudo:session): session closed for user root Aug 24 19:47:19 np0000008011 sudo[8777]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-awbwqfoqqwgcpsmuxliotvnmtdjlwhqd ; /usr/bin/python3' Aug 24 19:47:19 np0000008011 sudo[8777]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:47:20 np0000008011 sudo[8777]: pam_unix(sudo:session): session closed for user root Aug 24 19:47:20 np0000008011 sudo[8788]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-ztjlknmujejvaizqgzstkhgeztzjrwlx ; /usr/bin/python3' Aug 24 19:47:20 np0000008011 sudo[8788]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 19:47:20 np0000008011 sudo[8788]: pam_unix(sudo:session): session closed for user root Aug 24 20:24:03 np0000008011 kernel: storpool_rdma: netdevNotifier: our interface sp0 is going down! Aug 24 20:24:03 np0000008011 kernel: storpool_rdma: netdevNotifier: our interface sp0 is going down! Aug 24 20:24:05 np0000008011 kernel: storpool_rdma: netdevNotifier: our interface sp1 is going down! Aug 24 20:24:05 np0000008011 kernel: storpool_rdma: netdevNotifier: our interface sp1 is going down! Aug 24 20:24:28 np0000008011 kernel: sd 0:0:0:1: [sdb] Synchronizing SCSI cache Aug 24 20:24:28 np0000008011 kernel: sd 0:0:0:1: LUN assignments on this target have changed. The Linux SCSI layer does not automatically remap LUN assignments. Aug 24 20:24:28 np0000008011 kernel: sd 0:0:0:1: [sdb] Synchronize Cache(10) failed: Result: hostbyte=DID_OK driverbyte=DRIVER_OK Aug 24 20:24:28 np0000008011 kernel: sd 0:0:0:1: [sdb] Sense Key : Illegal Request [current] Aug 24 20:24:28 np0000008011 kernel: sd 0:0:0:1: [sdb] Add. Sense: Logical unit not supported Aug 24 20:25:11 np0000008011 sudo[19166]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-yoabdveasmqkkuddoevlnmksjbpzmgwi ; /usr/bin/python3' Aug 24 20:25:11 np0000008011 sudo[19166]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 20:25:12 np0000008011 sudo[19166]: pam_unix(sudo:session): session closed for user root Aug 24 20:25:12 np0000008011 sudo[19175]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-cpzkyohnamwbezdhcqpqywyogemokfim ; /usr/bin/python3' Aug 24 20:25:12 np0000008011 sudo[19175]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Aug 24 20:25:13 np0000008011 sudo[19175]: pam_unix(sudo:session): session closed for user root Aug 24 20:25:29 np0000008011 sudo[19234]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-jutupyvveghvwttxctcsfmfmzjrslksw ; /usr/bin/python3' Aug 24 20:25:29 np0000008011 sudo[19234]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)