Jul 20 15:51:25 np0000005515 sudo[2315]:   ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-xtsgcycuxvsbrvkzvyjzmmyddnrpzmaa ; /usr/bin/python3'
Jul 20 15:51:25 np0000005515 sudo[2315]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:51:25 np0000005515 sudo[2315]: pam_unix(sudo:session): session closed for user root
Jul 20 15:51:25 np0000005515 sudo[2333]:   ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-ytzpknfdydooymtkyjrxmlvhltrwrrcj ; /usr/bin/python3'
Jul 20 15:51:25 np0000005515 sudo[2333]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:51:26 np0000005515 sudo[2333]: pam_unix(sudo:session): session closed for user root
Jul 20 15:51:26 np0000005515 sudo[2342]:   ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-svjabnawjwfsmvggicjfaczvlmfabqzm ; /usr/bin/python3'
Jul 20 15:51:26 np0000005515 sudo[2342]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:51:26 np0000005515 sudo[2342]: pam_unix(sudo:session): session closed for user root
Jul 20 15:51:30 np0000005515 sudo[2375]:   ubuntu : PWD=/home/ubuntu ; USER=stack ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-hcbpvqxdnjhdafirwowrkeijhadgemms ; /usr/bin/python3'
Jul 20 15:51:30 np0000005515 sudo[2375]: pam_unix(sudo:session): session opened for user stack(uid=1002) by ubuntu(uid=1000)
Jul 20 15:51:30 np0000005515 sudo[2375]: pam_unix(sudo:session): session closed for user stack
Jul 20 15:51:31 np0000005515 sudo[2431]:   ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-wqzcgotntroyjopqvgmjrofnzzezhylg ; /usr/bin/python3'
Jul 20 15:51:31 np0000005515 sudo[2431]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:51:31 np0000005515 sudo[2431]: pam_unix(sudo:session): session closed for user root
Jul 20 15:51:31 np0000005515 sudo[2436]:   ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-jtwwlamgwqducpalrisxixeebzhesovw ; /usr/bin/python3'
Jul 20 15:51:31 np0000005515 sudo[2436]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:51:32 np0000005515 sudo[2436]: pam_unix(sudo:session): session closed for user root
Jul 20 15:51:32 np0000005515 sudo[2441]:   ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-ryykwlesjbaevuzdexgubtibnobpzvau ; /usr/bin/python3'
Jul 20 15:51:32 np0000005515 sudo[2441]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:51:33 np0000005515 sudo[2441]: pam_unix(sudo:session): session closed for user root
Jul 20 15:51:33 np0000005515 sudo[2582]:   ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-fesgcanjznkalbyyxrdrsqvtzwluehrz ; /usr/bin/python3'
Jul 20 15:51:33 np0000005515 sudo[2582]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:51:33 np0000005515 sudo[2582]: pam_unix(sudo:session): session closed for user root
Jul 20 15:51:33 np0000005515 sudo[2630]:   ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-wfixtwnzepwdmfxzvxohczniolxzmjsy ; /usr/bin/python3'
Jul 20 15:51:33 np0000005515 sudo[2630]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:51:34 np0000005515 sudo[2630]: pam_unix(sudo:session): session closed for user root
Jul 20 15:51:34 np0000005515 sudo[2678]:   ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-ydkgndsnghilpuapveggdoidjxqiykim ; /usr/bin/python3'
Jul 20 15:51:34 np0000005515 sudo[2678]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:51:34 np0000005515 sudo[2678]: pam_unix(sudo:session): session closed for user root
Jul 20 15:51:34 np0000005515 sudo[2727]:   ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-lfqdcdpppryvxifhruqeqwjvtyknugod ; /usr/bin/python3'
Jul 20 15:51:34 np0000005515 sudo[2727]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:51:35 np0000005515 sudo[2727]: pam_unix(sudo:session): session closed for user root
Jul 20 15:51:36 np0000005515 sudo[2780]:   ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-tipuadpkynhjentlualfnpvivepfthhb ; /usr/bin/python3'
Jul 20 15:51:36 np0000005515 sudo[2780]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:51:36 np0000005515 sudo[2780]: pam_unix(sudo:session): session closed for user root
Jul 20 15:51:39 np0000005515 sudo[2849]:   ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-xperztqhcedagmdjghfkobvnmmauogwt ; /usr/bin/python3'
Jul 20 15:51:39 np0000005515 sudo[2849]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:52:05 np0000005515 sudo[2849]: pam_unix(sudo:session): session closed for user root
Jul 20 15:52:11 np0000005515 sudo[7923]:   ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-uarxbwcudhfmithghlmgpetqzjqklxsl ; /usr/bin/python3'
Jul 20 15:52:11 np0000005515 sudo[7923]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:52:12 np0000005515 sudo[7923]: pam_unix(sudo:session): session closed for user root
Jul 20 15:52:12 np0000005515 sudo[7931]:   ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-ftogrwisvmwiucwnqyqjqnjfnhqejeyj ; /usr/bin/python3'
Jul 20 15:52:12 np0000005515 sudo[7931]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:52:12 np0000005515 sudo[7931]: pam_unix(sudo:session): session closed for user root
Jul 20 15:53:33 np0000005515 kernel: pci 0000:07:00.0: [1af4:1041] type 00 class 0x020000 PCIe Endpoint
Jul 20 15:53:33 np0000005515 kernel: pci 0000:07:00.0: BAR 1 [mem 0x00000000-0x00000fff]
Jul 20 15:53:33 np0000005515 kernel: pci 0000:07:00.0: BAR 4 [mem 0x00000000-0x00003fff 64bit pref]
Jul 20 15:53:33 np0000005515 kernel: pci 0000:07:00.0: ROM [mem 0x00000000-0x0007ffff pref]
Jul 20 15:53:33 np0000005515 kernel: pci 0000:07:00.0: ROM [mem 0xfe000000-0xfe07ffff pref]: assigned
Jul 20 15:53:33 np0000005515 kernel: pci 0000:07:00.0: BAR 4 [mem 0xc160000000-0xc160003fff 64bit pref]: assigned
Jul 20 15:53:33 np0000005515 kernel: pci 0000:07:00.0: BAR 1 [mem 0xfe080000-0xfe080fff]: assigned
Jul 20 15:53:33 np0000005515 kernel: virtio-pci 0000:07:00.0: enabling device (0000 -> 0002)
Jul 20 15:53:33 np0000005515 kernel: virtio_net virtio5 enp7s0: renamed from eth0
Jul 20 15:53:44 np0000005515 kernel: pci 0000:08:00.0: [1af4:1041] type 00 class 0x020000 PCIe Endpoint
Jul 20 15:53:44 np0000005515 kernel: pci 0000:08:00.0: BAR 1 [mem 0x00000000-0x00000fff]
Jul 20 15:53:44 np0000005515 kernel: pci 0000:08:00.0: BAR 4 [mem 0x00000000-0x00003fff 64bit pref]
Jul 20 15:53:44 np0000005515 kernel: pci 0000:08:00.0: ROM [mem 0x00000000-0x0007ffff pref]
Jul 20 15:53:44 np0000005515 kernel: pci 0000:08:00.0: ROM [mem 0xfde00000-0xfde7ffff pref]: assigned
Jul 20 15:53:44 np0000005515 kernel: pci 0000:08:00.0: BAR 4 [mem 0xc140000000-0xc140003fff 64bit pref]: assigned
Jul 20 15:53:44 np0000005515 kernel: pci 0000:08:00.0: BAR 1 [mem 0xfde80000-0xfde80fff]: assigned
Jul 20 15:53:44 np0000005515 kernel: virtio-pci 0000:08:00.0: enabling device (0000 -> 0002)
Jul 20 15:53:44 np0000005515 kernel: virtio_net virtio6 enp8s0: renamed from eth0
Jul 20 15:53:54 np0000005515 kernel: pci 0000:09:00.0: [1af4:1041] type 00 class 0x020000 PCIe Endpoint
Jul 20 15:53:54 np0000005515 kernel: pci 0000:09:00.0: BAR 1 [mem 0x00000000-0x00000fff]
Jul 20 15:53:54 np0000005515 kernel: pci 0000:09:00.0: BAR 4 [mem 0x00000000-0x00003fff 64bit pref]
Jul 20 15:53:54 np0000005515 kernel: pci 0000:09:00.0: ROM [mem 0x00000000-0x0007ffff pref]
Jul 20 15:53:54 np0000005515 kernel: pci 0000:09:00.0: ROM [mem 0xfdc00000-0xfdc7ffff pref]: assigned
Jul 20 15:53:54 np0000005515 kernel: pci 0000:09:00.0: BAR 4 [mem 0xc120000000-0xc120003fff 64bit pref]: assigned
Jul 20 15:53:54 np0000005515 kernel: pci 0000:09:00.0: BAR 1 [mem 0xfdc80000-0xfdc80fff]: assigned
Jul 20 15:53:54 np0000005515 kernel: virtio-pci 0000:09:00.0: enabling device (0000 -> 0002)
Jul 20 15:53:54 np0000005515 kernel: virtio_net virtio7 enp9s0: renamed from eth0
Jul 20 15:54:50 np0000005515 kernel: sd 0:0:0:0: LUN assignments on this target have changed. The Linux SCSI layer does not automatically remap LUN assignments.
Jul 20 15:54:50 np0000005515 kernel: scsi 0:0:0:1: Direct-Access     QEMU     QEMU HARDDISK    2.5+ PQ: 0 ANSI: 5
Jul 20 15:54:50 np0000005515 kernel: sd 0:0:0:1: Attached scsi generic sg1 type 0
Jul 20 15:54:50 np0000005515 kernel: sd 0:0:0:1: Power-on or device reset occurred
Jul 20 15:54:50 np0000005515 kernel: sd 0:0:0:1: [sdb] 482344960 512-byte logical blocks: (247 GB/230 GiB)
Jul 20 15:54:50 np0000005515 kernel: sd 0:0:0:1: [sdb] Write Protect is off
Jul 20 15:54:50 np0000005515 kernel: sd 0:0:0:1: [sdb] Mode Sense: 63 00 00 08
Jul 20 15:54:50 np0000005515 kernel: sd 0:0:0:1: [sdb] Write cache: enabled, read cache: enabled, doesn't support DPO or FUA
Jul 20 15:54:50 np0000005515 kernel: sd 0:0:0:1: [sdb] Attached SCSI disk
Jul 20 15:54:51 np0000005515 sudo[8059]:   ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-xxwkoxbauoyowsyfqksiylbtgvqdkmee ; /usr/bin/python3'
Jul 20 15:54:51 np0000005515 sudo[8059]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:54:51 np0000005515 sudo[8059]: pam_unix(sudo:session): session closed for user root
Jul 20 15:54:51 np0000005515 sudo[8068]:   ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-dybggnbrltyheonayhaknevcrhdymxpf ; /usr/bin/python3'
Jul 20 15:54:51 np0000005515 sudo[8068]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:54:51 np0000005515 sudo[8068]: pam_unix(sudo:session): session closed for user root
Jul 20 15:54:51 np0000005515 sudo[8076]:   ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-kkugciqiuilcubfbsuuiwfxyupqujtjs ; /usr/bin/python3'
Jul 20 15:54:51 np0000005515 sudo[8076]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:54:52 np0000005515 sudo[8076]: pam_unix(sudo:session): session closed for user root
Jul 20 15:54:52 np0000005515 sudo[8130]:   ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-nqkmplelcthfxpalgeuayuksqaesqdve ; /usr/bin/python3'
Jul 20 15:54:52 np0000005515 sudo[8130]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:54:53 np0000005515 kernel: virtio_net virtio5 sp-api: renamed from enp7s0
Jul 20 15:54:53 np0000005515 kernel: virtio_net virtio6 sp0: renamed from enp8s0
Jul 20 15:54:53 np0000005515 kernel: virtio_net virtio7 sp1: renamed from enp9s0
Jul 20 15:54:53 np0000005515 kernel: 8021q: adding VLAN 0 to HW filter on device sp-api
Jul 20 15:54:53 np0000005515 kernel: 8021q: adding VLAN 0 to HW filter on device sp0
Jul 20 15:54:53 np0000005515 kernel: 8021q: adding VLAN 0 to HW filter on device sp1
Jul 20 15:54:53 np0000005515 sudo[8130]: pam_unix(sudo:session): session closed for user root
Jul 20 15:55:45 np0000005515 sudo[8339]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-aljclygiamczfdtxyeghkdhppngvggaw ; cat /etc/os-release'
Jul 20 15:55:45 np0000005515 sudo[8339]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:55:45 np0000005515 sudo[8339]: pam_unix(sudo:session): session closed for user root
Jul 20 15:55:45 np0000005515 sudo[8343]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-tcdpzsmadcynjvhesbowroaatiavdyae ; apt-get update && env DEBIAN_FRONTEND=noninteractive apt-get install -y python3'
Jul 20 15:55:45 np0000005515 sudo[8343]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:55:47 np0000005515 sudo[8343]: pam_unix(sudo:session): session closed for user root
Jul 20 15:55:49 np0000005515 sudo[8721]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-hkezxwgzolownhhzelcqmuljwikaulgn ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784562948.8526597-9924-27740816412714/AnsiballZ_apt.py'
Jul 20 15:55:49 np0000005515 sudo[8721]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:55:50 np0000005515 sudo[8721]: pam_unix(sudo:session): session closed for user root
Jul 20 15:55:50 np0000005515 sudo[9004]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-vzqajffcnxqgtzfbdssjetazroyspuhr ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784562950.8865185-9940-228550279124845/AnsiballZ_apt.py'
Jul 20 15:55:50 np0000005515 sudo[9004]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:55:59 np0000005515 sudo[9004]: pam_unix(sudo:session): session closed for user root
Jul 20 15:56:00 np0000005515 sudo[14586]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-rlibpplfoxuqtutpfqtxfwttsdfunnel ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784562959.8473089-9960-117219919728828/AnsiballZ_get_url.py'
Jul 20 15:56:00 np0000005515 sudo[14586]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:56:00 np0000005515 sudo[14586]: pam_unix(sudo:session): session closed for user root
Jul 20 15:56:00 np0000005515 sudo[14604]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-srcrnnqazydjmfzssyvgqlnrfdzzypho ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784562960.5187213-9976-249593755203548/AnsiballZ_stat.py'
Jul 20 15:56:00 np0000005515 sudo[14604]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:56:00 np0000005515 sudo[14604]: pam_unix(sudo:session): session closed for user root
Jul 20 15:56:01 np0000005515 sudo[14615]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-avavslhjnmfmvdhglbbgjnvtjycvsjxj ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784562960.5187213-9976-249593755203548/AnsiballZ_copy.py'
Jul 20 15:56:01 np0000005515 sudo[14615]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:56:01 np0000005515 sudo[14615]: pam_unix(sudo:session): session closed for user root
Jul 20 15:56:01 np0000005515 sudo[14633]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-qkjapsksmhaoxmzoieafpqjrfotaludn ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784562961.5358217-10008-175086642413760/AnsiballZ_apt.py'
Jul 20 15:56:01 np0000005515 sudo[14633]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:56:04 np0000005515 sudo[14633]: pam_unix(sudo:session): session closed for user root
Jul 20 15:56:05 np0000005515 sudo[14958]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-cwwxmqufqoachlesvtbxwleynqfayisl ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784562965.2336922-10028-83154362646205/AnsiballZ_apt.py'
Jul 20 15:56:05 np0000005515 sudo[14958]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:56:14 np0000005515 sudo[14958]: pam_unix(sudo:session): session closed for user root
Jul 20 15:56:16 np0000005515 sudo[15118]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-gvuljzmmidonukwxsvgsagbyyofbjghi ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784562975.9755495-10082-25390826735517/AnsiballZ_apt.py'
Jul 20 15:56:16 np0000005515 sudo[15118]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:56:17 np0000005515 sudo[15118]: pam_unix(sudo:session): session closed for user root
Jul 20 15:56:18 np0000005515 sudo[15434]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-xzkeqdlxvzfkqhbzhcidieihrezovocg ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784562978.0615327-10102-60327020297127/AnsiballZ_apt.py'
Jul 20 15:56:18 np0000005515 sudo[15434]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:56:19 np0000005515 sudo[15434]: pam_unix(sudo:session): session closed for user root
Jul 20 15:56:19 np0000005515 sudo[15458]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-lhjxjnoczupmvmelaukvoonglqxflkmw ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784562979.334693-10122-276339571788234/AnsiballZ_apt.py'
Jul 20 15:56:19 np0000005515 sudo[15458]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:56:35 np0000005515 kernel: Key type psk registered
Jul 20 15:56:38 np0000005515 kernel: audit: type=1400 audit(1784562998.155:125): apparmor="STATUS" operation="profile_load" profile="unconfined" name="/usr/sbin/chronyd" pid=17057 comm="apparmor_parser"
Jul 20 15:56:42 np0000005515 sudo[15458]: pam_unix(sudo:session): session closed for user root
Jul 20 15:56:42 np0000005515 sudo[17320]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-yauyprtnwklhplvkhxgdwvdanysyvrvy ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563002.6866772-10140-182076969448280/AnsiballZ_stat.py'
Jul 20 15:56:42 np0000005515 sudo[17320]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:56:43 np0000005515 sudo[17320]: pam_unix(sudo:session): session closed for user root
Jul 20 15:56:43 np0000005515 sudo[17331]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-cwbgpbmkbmjvabvqxyunotvhhtlxoysm ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563002.6866772-10140-182076969448280/AnsiballZ_copy.py'
Jul 20 15:56:43 np0000005515 sudo[17331]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:56:43 np0000005515 sudo[17331]: pam_unix(sudo:session): session closed for user root
Jul 20 15:56:43 np0000005515 sudo[17349]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-dtgkaybgkblafnmpijnrepldyouhayox ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563003.5128756-10170-189902079134876/AnsiballZ_mount.py'
Jul 20 15:56:43 np0000005515 sudo[17349]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:56:43 np0000005515 sudo[17349]: pam_unix(sudo:session): session closed for user root
Jul 20 15:56:44 np0000005515 sudo[17368]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-dyqlxaigiagwrldsogjclysssxakfjku ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563004.052776-10186-225172547275464/AnsiballZ_command.py'
Jul 20 15:56:44 np0000005515 sudo[17368]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:56:44 np0000005515 sudo[17368]: pam_unix(sudo:session): session closed for user root
Jul 20 15:56:44 np0000005515 sudo[17387]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-rcvveqootslidmhzveaxrxwexajcumux ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563004.5805504-10202-132286586634367/AnsiballZ_lineinfile.py'
Jul 20 15:56:44 np0000005515 sudo[17387]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:56:45 np0000005515 sudo[17387]: pam_unix(sudo:session): session closed for user root
Jul 20 15:56:46 np0000005515 sudo[17452]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-untodgebksyvukcgeawliqxpdgvuyklm ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563006.3356864-10266-10407705347484/AnsiballZ_lineinfile.py'
Jul 20 15:56:46 np0000005515 sudo[17452]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:56:46 np0000005515 sudo[17452]: pam_unix(sudo:session): session closed for user root
Jul 20 15:56:50 np0000005515 sudo[17937]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-kykyfjcpezyssfziuhrvoppathfqkhyb ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563010.015197-10298-2634375042718/AnsiballZ_systemd.py'
Jul 20 15:56:50 np0000005515 sudo[17937]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:56:50 np0000005515 sudo[17937]: pam_unix(sudo:session): session closed for user root
Jul 20 15:56:53 np0000005515 sudo[17974]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-mhjswruubfxqhvlzxhxkxdrqzrjjtfcp ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563012.9422624-10340-57306741486274/AnsiballZ_lineinfile.py'
Jul 20 15:56:53 np0000005515 sudo[17974]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:56:53 np0000005515 sudo[17974]: pam_unix(sudo:session): session closed for user root
Jul 20 15:56:53 np0000005515 sudo[17992]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-wjrtvvnmswfxbohdhkuiirkgvldqstle ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563013.3218553-10340-1022934643945/AnsiballZ_lineinfile.py'
Jul 20 15:56:53 np0000005515 sudo[17992]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:56:53 np0000005515 sudo[17992]: pam_unix(sudo:session): session closed for user root
Jul 20 15:56:53 np0000005515 sudo[18010]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-gtlilmukbqiacmevibvvpvdjaurgtnog ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563013.7608197-10370-237849119050822/AnsiballZ_systemd.py'
Jul 20 15:56:53 np0000005515 sudo[18010]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:56:54 np0000005515 sudo[18010]: pam_unix(sudo:session): session closed for user root
Jul 20 15:56:54 np0000005515 sudo[18076]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-fgihcnbyedoualurejekhefbweayphor ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563014.5979774-10370-129072850601007/AnsiballZ_systemd.py'
Jul 20 15:56:54 np0000005515 sudo[18076]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:56:55 np0000005515 sudo[18076]: pam_unix(sudo:session): session closed for user root
Jul 20 15:56:56 np0000005515 sudo[18098]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-rlkeecypmqauiixnbfialrsakrkjjnnf ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563016.1443365-10400-234863969356071/AnsiballZ_lineinfile.py'
Jul 20 15:56:56 np0000005515 sudo[18098]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:56:56 np0000005515 sudo[18098]: pam_unix(sudo:session): session closed for user root
Jul 20 15:56:56 np0000005515 sudo[18116]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-lqqmifrjtmhedhapbzlsrrmvbaiwvwpz ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563016.635673-10416-254151097888125/AnsiballZ_systemd.py'
Jul 20 15:56:56 np0000005515 sudo[18116]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:56:57 np0000005515 sudo[18116]: pam_unix(sudo:session): session closed for user root
Jul 20 15:56:58 np0000005515 sudo[18277]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-glblcaegumwchrgcnwvieydjmlvqiezb ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563018.8690982-10468-251140157305509/AnsiballZ_stat.py'
Jul 20 15:56:58 np0000005515 sudo[18277]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:56:59 np0000005515 sudo[18277]: pam_unix(sudo:session): session closed for user root
Jul 20 15:56:59 np0000005515 sudo[18288]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-ihpzzhmesrzmffyzxwgudjwxbekzuohb ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563018.8690982-10468-251140157305509/AnsiballZ_copy.py'
Jul 20 15:56:59 np0000005515 sudo[18288]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:56:59 np0000005515 sudo[18288]: pam_unix(sudo:session): session closed for user root
Jul 20 15:57:00 np0000005515 sudo[18321]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-estibcaqrehclrheybgrngeznbvavebx ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563020.1532326-10514-246124657358547/AnsiballZ_file.py'
Jul 20 15:57:00 np0000005515 sudo[18321]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:57:00 np0000005515 sudo[18321]: pam_unix(sudo:session): session closed for user root
Jul 20 15:57:00 np0000005515 sudo[18339]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-enokqkhdxiqceyigqrmlonyxgmlshyul ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563020.5756838-10514-235604682398954/AnsiballZ_file.py'
Jul 20 15:57:00 np0000005515 sudo[18339]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:57:00 np0000005515 sudo[18339]: pam_unix(sudo:session): session closed for user root
Jul 20 15:57:01 np0000005515 sudo[18357]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-elzgxvgmaqjcazlrnpehionolxbjdzig ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563020.9485984-10514-210025586555475/AnsiballZ_file.py'
Jul 20 15:57:01 np0000005515 sudo[18357]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:57:01 np0000005515 sudo[18357]: pam_unix(sudo:session): session closed for user root
Jul 20 15:57:01 np0000005515 sudo[18375]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-tpnoqkvbhdbulyzdeiofwhayetxqdufx ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563021.2924972-10514-253517280556401/AnsiballZ_file.py'
Jul 20 15:57:01 np0000005515 sudo[18375]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:57:01 np0000005515 sudo[18375]: pam_unix(sudo:session): session closed for user root
Jul 20 15:57:01 np0000005515 sudo[18393]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-dmrxxfmhipsyoadvxbdxgqpnafgiauak ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563021.6354997-10514-55336361674345/AnsiballZ_file.py'
Jul 20 15:57:01 np0000005515 sudo[18393]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:57:01 np0000005515 sudo[18393]: pam_unix(sudo:session): session closed for user root
Jul 20 15:57:02 np0000005515 sudo[18411]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-jjymxwpiqhskqjzlfqaffplokwwqxcpl ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563022.607373-10602-59156977543417/AnsiballZ_apt.py'
Jul 20 15:57:02 np0000005515 sudo[18411]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:57:03 np0000005515 sudo[18411]: pam_unix(sudo:session): session closed for user root
Jul 20 15:57:03 np0000005515 sudo[18435]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-juszuedgdotxtwidsrnmpyknqecwhymz ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563023.6886766-10618-23121430831510/AnsiballZ_apt.py'
Jul 20 15:57:03 np0000005515 sudo[18435]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:57:04 np0000005515 sudo[18435]: pam_unix(sudo:session): session closed for user root
Jul 20 15:57:06 np0000005515 sudo[18489]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-blamxcllnsjhrzgqtzcacoiiigjtsroh ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563026.6546907-10690-207671478602351/AnsiballZ_stat.py'
Jul 20 15:57:06 np0000005515 sudo[18489]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:57:06 np0000005515 sudo[18489]: pam_unix(sudo:session): session closed for user root
Jul 20 15:57:07 np0000005515 sudo[18500]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-ueaxdbmxchkxfagidbeqtyxnxkluknvg ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563026.6546907-10690-207671478602351/AnsiballZ_copy.py'
Jul 20 15:57:07 np0000005515 sudo[18500]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:57:07 np0000005515 sudo[18500]: pam_unix(sudo:session): session closed for user root
Jul 20 15:57:07 np0000005515 sudo[18518]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-smexsnwvtigfkfgdolekbgiblfbrjsfq ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563027.4647362-10720-73416307674906/AnsiballZ_command.py'
Jul 20 15:57:07 np0000005515 sudo[18518]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:57:08 np0000005515 sudo[18518]: pam_unix(sudo:session): session closed for user root
Jul 20 15:57:08 np0000005515 sudo[18538]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-lwfamyfcpwnecjktfeaeizuyaednbsuf ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563028.5785248-10738-84826867708323/AnsiballZ_file.py'
Jul 20 15:57:08 np0000005515 sudo[18538]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:57:08 np0000005515 sudo[18538]: pam_unix(sudo:session): session closed for user root
Jul 20 15:57:10 np0000005515 sudo[18557]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-wiinoowvfienyehwdculoawdlvygleda ; ANSIBLE_ASYNC_DIR=\'~/.ansible_async\' /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563029.847334-10798-55243310398769/async_wrapper.py j283461021899 1000 false /home/ubuntu/.ansible/tmp/ansible-tmp-1784563029.847334-10798-55243310398769/AnsiballZ_command.py /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563029.847334-10798-55243310398769/AnsiballZ_command.py'
Jul 20 15:57:10 np0000005515 sudo[18557]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:57:10 np0000005515 sudo[18557]: pam_unix(sudo:session): session closed for user root
Jul 20 15:57:11 np0000005515 sudo[18761]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-amqgpnitfdupzqjbdcjcxfdfvihylyav ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563031.518952-10850-55781905479560/AnsiballZ_async_status.py'
Jul 20 15:57:11 np0000005515 sudo[18761]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:57:11 np0000005515 sudo[18761]: pam_unix(sudo:session): session closed for user root
Jul 20 15:57:17 np0000005515 sudo[19253]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-onxaydqfeyonyershqbqaersazecyxem ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563037.021996-10850-35532023032818/AnsiballZ_async_status.py'
Jul 20 15:57:17 np0000005515 sudo[19253]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:57:17 np0000005515 sudo[19253]: pam_unix(sudo:session): session closed for user root
Jul 20 15:57:22 np0000005515 sudo[19272]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-rnfpsjzsgmidgklvhdtgwryzxwhncgvv ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563042.3654723-10850-52952879457900/AnsiballZ_async_status.py'
Jul 20 15:57:22 np0000005515 sudo[19272]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:57:22 np0000005515 sudo[19272]: pam_unix(sudo:session): session closed for user root
Jul 20 15:57:27 np0000005515 sudo[19302]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-bmpaeimkxikspohpewsncqgipasdyjva ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563047.7110846-10850-141095294167819/AnsiballZ_async_status.py'
Jul 20 15:57:27 np0000005515 sudo[19302]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:57:28 np0000005515 sudo[19302]: pam_unix(sudo:session): session closed for user root
Jul 20 15:57:33 np0000005515 sudo[19765]:   ubuntu : TTY=pts/1 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-pvycraqclxynrmczpvwmqboinkpiryjv ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563053.2011173-10850-110038912732544/AnsiballZ_async_status.py'
Jul 20 15:57:33 np0000005515 sudo[19765]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:57:33 np0000005515 sudo[19765]: pam_unix(sudo:session): session closed for user root
Jul 20 15:57:38 np0000005515 sudo[20004]:   ubuntu : TTY=pts/1 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-npaljaxdyggxvridroqhkkgvqwrimzbv ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563058.571351-10850-71167784014447/AnsiballZ_async_status.py'
Jul 20 15:57:38 np0000005515 sudo[20004]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:57:38 np0000005515 sudo[20004]: pam_unix(sudo:session): session closed for user root
Jul 20 15:57:44 np0000005515 sudo[21112]:   ubuntu : TTY=pts/1 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-gbxlbpwoyjurjyqwisjozwfkrccxrcok ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563063.947256-10850-214058225351501/AnsiballZ_async_status.py'
Jul 20 15:57:44 np0000005515 sudo[21112]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:57:44 np0000005515 sudo[21112]: pam_unix(sudo:session): session closed for user root
Jul 20 15:57:49 np0000005515 sudo[25129]:   ubuntu : TTY=pts/1 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-dvaedvxeiejjlurltvpqtuoelhurzzhj ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563069.301485-10850-106021698274808/AnsiballZ_async_status.py'
Jul 20 15:57:49 np0000005515 sudo[25129]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:57:49 np0000005515 sudo[25129]: pam_unix(sudo:session): session closed for user root
Jul 20 15:57:50 np0000005515 kernel: audit: type=1400 audit(1784563070.568:126): apparmor="STATUS" operation="profile_replace" info="same as current profile, skipping" profile="unconfined" name="rsyslogd" pid=25226 comm="apparmor_parser"
Jul 20 15:57:54 np0000005515 sudo[27825]:   ubuntu : TTY=pts/1 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-fmsqwmgubumedzwixilsppocqpercvle ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563074.638319-10850-83595229257315/AnsiballZ_async_status.py'
Jul 20 15:57:54 np0000005515 sudo[27825]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:57:54 np0000005515 sudo[27825]: pam_unix(sudo:session): session closed for user root
Jul 20 15:58:00 np0000005515 sudo[32196]:   ubuntu : TTY=pts/1 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-jowudexeyyxureiaufuaamoknxluuubm ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563079.9854467-10850-157903940142681/AnsiballZ_async_status.py'
Jul 20 15:58:00 np0000005515 sudo[32196]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:58:00 np0000005515 sudo[32196]: pam_unix(sudo:session): session closed for user root
Jul 20 15:58:05 np0000005515 sudo[33028]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-gvxwmrsqqshjstcjrsxurnjajhbzeqgi ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563085.3424323-10850-31831457747846/AnsiballZ_async_status.py'
Jul 20 15:58:05 np0000005515 sudo[33028]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:58:05 np0000005515 sudo[33028]: pam_unix(sudo:session): session closed for user root
Jul 20 15:58:10 np0000005515 sudo[33436]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-wchaznofebxrbmhqlnbqpleryrqozoar ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563090.7107484-10850-143257780763946/AnsiballZ_async_status.py'
Jul 20 15:58:10 np0000005515 sudo[33436]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:58:11 np0000005515 sudo[33436]: pam_unix(sudo:session): session closed for user root
Jul 20 15:58:11 np0000005515 kernel: audit: type=1400 audit(1784563091.345:127): apparmor="STATUS" operation="profile_replace" info="same as current profile, skipping" profile="unconfined" name="rsyslogd" pid=33462 comm="apparmor_parser"
Jul 20 15:58:16 np0000005515 sudo[33666]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-zesiapoblbslfaqrsiswaascfoneerdw ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563096.119641-10850-230266914880025/AnsiballZ_async_status.py'
Jul 20 15:58:16 np0000005515 sudo[33666]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:58:16 np0000005515 sudo[33666]: pam_unix(sudo:session): session closed for user root
Jul 20 15:58:17 np0000005515 kernel: audit: type=1400 audit(1784563097.354:128): apparmor="STATUS" operation="profile_replace" profile="unconfined" name="tcpdump" pid=33674 comm="apparmor_parser"
Jul 20 15:58:21 np0000005515 sudo[37219]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-bikfldppbnrtackumnqutnlhnedrvcla ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563101.4847286-10850-21500006705083/AnsiballZ_async_status.py'
Jul 20 15:58:21 np0000005515 sudo[37219]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:58:21 np0000005515 sudo[37219]: pam_unix(sudo:session): session closed for user root
Jul 20 15:58:26 np0000005515 sudo[40475]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-gbtqhfsfsxlfbmihzloomragfeqzsilq ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563106.8809988-10850-197963148293816/AnsiballZ_async_status.py'
Jul 20 15:58:26 np0000005515 sudo[40475]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:58:27 np0000005515 sudo[40475]: pam_unix(sudo:session): session closed for user root
Jul 20 15:58:32 np0000005515 sudo[41783]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-wingtaoeligwmfgxamcwwxnzfctjwuad ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563112.255543-10850-149896890306391/AnsiballZ_async_status.py'
Jul 20 15:58:32 np0000005515 sudo[41783]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:58:32 np0000005515 sudo[41783]: pam_unix(sudo:session): session closed for user root
Jul 20 15:58:32 np0000005515 sudo[41801]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-dmzvotmlpvjvqrwfsrewixkstedtzkhf ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563112.6697469-11111-84199579436203/AnsiballZ_systemd.py'
Jul 20 15:58:32 np0000005515 sudo[41801]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:58:33 np0000005515 kernel: audit: type=1400 audit(1784563113.206:129): apparmor="STATUS" operation="profile_replace" info="same as current profile, skipping" profile="unconfined" name="rsyslogd" pid=41815 comm="apparmor_parser"
Jul 20 15:58:33 np0000005515 sudo[41801]: pam_unix(sudo:session): session closed for user root
Jul 20 15:58:33 np0000005515 sudo[41835]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-cbjpskvlqevxfxdukjanqmueuuplaqlb ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563113.4306414-11127-84830937245062/AnsiballZ_command.py'
Jul 20 15:58:33 np0000005515 sudo[41835]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:58:33 np0000005515 sudo[41835]: pam_unix(sudo:session): session closed for user root
Jul 20 15:58:34 np0000005515 sudo[41854]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-klchevlmncwmvdndgrvlszxbwphrlchc ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563114.0161524-11147-231710490973357/AnsiballZ_command.py'
Jul 20 15:58:34 np0000005515 sudo[41854]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:58:34 np0000005515 sudo[41854]: pam_unix(sudo:session): session closed for user root
Jul 20 15:58:34 np0000005515 sudo[41873]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-moelppberojshhiwlsxwijvevvrnymuv ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563114.571535-11163-85297819177901/AnsiballZ_lineinfile.py'
Jul 20 15:58:34 np0000005515 sudo[41873]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:58:34 np0000005515 sudo[41873]: pam_unix(sudo:session): session closed for user root
Jul 20 15:58:35 np0000005515 sudo[41891]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-kqciirezneuxiendadvfvspnnfgpzdxi ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563115.2064297-11185-165673392882164/AnsiballZ_command.py'
Jul 20 15:58:35 np0000005515 sudo[41891]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:58:35 np0000005515 sudo[41891]: pam_unix(sudo:session): session closed for user root
Jul 20 15:58:35 np0000005515 sudo[41913]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-xqteqzfyupqfwebzjwososbmniioxjop ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563115.7138312-11201-102448629463479/AnsiballZ_systemd.py'
Jul 20 15:58:35 np0000005515 sudo[41913]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:58:36 np0000005515 sudo[41913]: pam_unix(sudo:session): session closed for user root
Jul 20 15:58:36 np0000005515 sudo[41933]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-tyargmrztfwlyvwwayawgljwtrgvdret ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563116.453811-11219-32915629724391/AnsiballZ_stat.py'
Jul 20 15:58:36 np0000005515 sudo[41933]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:58:36 np0000005515 sudo[41933]: pam_unix(sudo:session): session closed for user root
Jul 20 15:58:36 np0000005515 sudo[41944]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-iakwlzopklmudlgyxlqudvxlzqvllslx ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563116.453811-11219-32915629724391/AnsiballZ_copy.py'
Jul 20 15:58:36 np0000005515 sudo[41944]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:58:37 np0000005515 sudo[41944]: pam_unix(sudo:session): session closed for user root
Jul 20 15:58:37 np0000005515 sudo[41962]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-efazbwnfzufnrvbhvzjkvdtpuluuriyf ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563117.2846513-11251-102642074579518/AnsiballZ_file.py'
Jul 20 15:58:37 np0000005515 sudo[41962]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:58:37 np0000005515 sudo[41962]: pam_unix(sudo:session): session closed for user root
Jul 20 15:58:37 np0000005515 sudo[41980]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-sdlcocszkygvtnoruafzjhuyyvyjfknv ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563117.784718-11267-242147061140394/AnsiballZ_get_url.py'
Jul 20 15:58:37 np0000005515 sudo[41980]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:58:38 np0000005515 sudo[41980]: pam_unix(sudo:session): session closed for user root
Jul 20 15:58:38 np0000005515 sudo[41998]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-kxnztzhcrwuclpbsqynigfebjlupkiyu ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563118.415506-11283-127305024889632/AnsiballZ_file.py'
Jul 20 15:58:38 np0000005515 sudo[41998]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:58:38 np0000005515 sudo[41998]: pam_unix(sudo:session): session closed for user root
Jul 20 15:58:39 np0000005515 sudo[42016]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-rwsimvutqpdqshztazmursiegiizyphg ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563119.1387022-11307-7230543257492/AnsiballZ_stat.py'
Jul 20 15:58:39 np0000005515 sudo[42016]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:58:39 np0000005515 sudo[42016]: pam_unix(sudo:session): session closed for user root
Jul 20 15:58:39 np0000005515 sudo[42034]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-yxyzectzhnujoymxktikyprvbmscbyzh ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563119.5892637-11323-208967844562094/AnsiballZ_command.py'
Jul 20 15:58:39 np0000005515 sudo[42034]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:58:40 np0000005515 sudo[42034]: pam_unix(sudo:session): session closed for user root
Jul 20 15:58:41 np0000005515 sudo[42451]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-pdgmxmwgettmozrothoytkajqzmccqir ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563120.9037058-11347-97145897998179/AnsiballZ_command.py'
Jul 20 15:58:41 np0000005515 sudo[42451]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:58:53 np0000005515 sudo[42451]: pam_unix(sudo:session): session closed for user root
Jul 20 15:58:53 np0000005515 sudo[50372]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-evqhekglaqglzjqedoqpzphhqlayznkl ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563133.6557257-11364-52674635579277/AnsiballZ_setup.py'
Jul 20 15:58:53 np0000005515 sudo[50372]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:58:54 np0000005515 sudo[50372]: pam_unix(sudo:session): session closed for user root
Jul 20 15:58:54 np0000005515 sudo[50410]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-gnhyslbjcoouhcxiqdbifrcirrtwbeoo ; cat /proc/sys/kernel/random/boot_id'
Jul 20 15:58:54 np0000005515 sudo[50410]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:58:54 np0000005515 sudo[50410]: pam_unix(sudo:session): session closed for user root
Jul 20 15:58:54 np0000005515 sudo[50418]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-mwtkcomlpxtofwkufbywtptgzprgloho ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563133.6557257-11364-52674635579277/AnsiballZ_find.py'
Jul 20 15:58:54 np0000005515 sudo[50418]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:58:54 np0000005515 sudo[50418]: pam_unix(sudo:session): session closed for user root
Jul 20 15:58:54 np0000005515 sudo[50423]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-cpzyiehryroshbjuzvnzbgqpmnyvvbhf ; /sbin/shutdown -r 0 "Reboot initiated by Ansible"'
Jul 20 15:58:54 np0000005515 sudo[50423]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:58:54 np0000005515 sudo[50423]: pam_unix(sudo:session): session closed for user root
Jul 20 15:58:55 np0000005515 kernel: EXT4-fs (sda16): unmounting filesystem 7dc15ce9-d090-44d7-bb05-2a36d545a8e3.
-- Boot b5ea4e16efbc498e9d40cb72cba8604d --
Jul 20 15:59:03 np0000005515 kernel: Linux version 6.8.0-136-generic (buildd@lcy02-amd64-041) (x86_64-linux-gnu-gcc-13 (Ubuntu 13.3.0-6ubuntu2~24.04.1) 13.3.0, GNU ld (GNU Binutils for Ubuntu) 2.42) #136-Ubuntu SMP PREEMPT_DYNAMIC Wed Jul  1 21:53:05 UTC 2026 (Ubuntu 6.8.0-136.136-generic 6.8.12)
Jul 20 15:59:03 np0000005515 kernel: Command line: BOOT_IMAGE=/vmlinuz-6.8.0-136-generic root=UUID=8515de1c-ba7e-467b-adde-6d9f8a8dbc1f ro amd_pstate=guided nomodeset vga=normal libata.fua=1 i915.modeset=0 nofb video=vesafb:off systemd.legacy_systemd_cgroup_controller=1 swapaccount=1 usbcore.autosuspend=-1 systemd.unified_cgroup_hierarchy=0 console=tty1 console=ttyS0 crashkernel=1024M
Jul 20 15:59:03 np0000005515 kernel: KERNEL supported cpus:
Jul 20 15:59:03 np0000005515 kernel:   Intel GenuineIntel
Jul 20 15:59:03 np0000005515 kernel:   AMD AuthenticAMD
Jul 20 15:59:03 np0000005515 kernel:   Hygon HygonGenuine
Jul 20 15:59:03 np0000005515 kernel:   Centaur CentaurHauls
Jul 20 15:59:03 np0000005515 kernel:   zhaoxin   Shanghai  
Jul 20 15:59:03 np0000005515 kernel: BIOS-provided physical RAM map:
Jul 20 15:59:03 np0000005515 kernel: BIOS-e820: [mem 0x0000000000000000-0x000000000009fbff] usable
Jul 20 15:59:03 np0000005515 kernel: BIOS-e820: [mem 0x000000000009fc00-0x000000000009ffff] reserved
Jul 20 15:59:03 np0000005515 kernel: BIOS-e820: [mem 0x00000000000f0000-0x00000000000fffff] reserved
Jul 20 15:59:03 np0000005515 kernel: BIOS-e820: [mem 0x0000000000100000-0x000000007ffdafff] usable
Jul 20 15:59:03 np0000005515 kernel: BIOS-e820: [mem 0x000000007ffdb000-0x000000007fffffff] reserved
Jul 20 15:59:03 np0000005515 kernel: BIOS-e820: [mem 0x00000000b0000000-0x00000000bfffffff] reserved
Jul 20 15:59:03 np0000005515 kernel: BIOS-e820: [mem 0x00000000fed1c000-0x00000000fed1ffff] reserved
Jul 20 15:59:03 np0000005515 kernel: BIOS-e820: [mem 0x00000000feffc000-0x00000000feffffff] reserved
Jul 20 15:59:03 np0000005515 kernel: BIOS-e820: [mem 0x00000000fffc0000-0x00000000ffffffff] reserved
Jul 20 15:59:03 np0000005515 kernel: BIOS-e820: [mem 0x0000000100000000-0x000000067fffffff] usable
Jul 20 15:59:03 np0000005515 kernel: BIOS-e820: [mem 0x000000fd00000000-0x000000ffffffffff] reserved
Jul 20 15:59:03 np0000005515 kernel: NX (Execute Disable) protection: active
Jul 20 15:59:03 np0000005515 kernel: APIC: Static calls initialized
Jul 20 15:59:03 np0000005515 kernel: SMBIOS 3.0.0 present.
Jul 20 15:59:03 np0000005515 kernel: DMI: OpenStack Foundation OpenStack Nova, BIOS 1.16.3-debian-1.16.3-2 04/01/2014
Jul 20 15:59:03 np0000005515 kernel: Hypervisor detected: KVM
Jul 20 15:59:03 np0000005515 kernel: kvm-clock: Using msrs 4b564d01 and 4b564d00
Jul 20 15:59:03 np0000005515 kernel: kvm-clock: using sched offset of 655051536120 cycles
Jul 20 15:59:03 np0000005515 kernel: clocksource: kvm-clock: mask: 0xffffffffffffffff max_cycles: 0x1cd42e4dffb, max_idle_ns: 881590591483 ns
Jul 20 15:59:03 np0000005515 kernel: tsc: Detected 2395.498 MHz processor
Jul 20 15:59:03 np0000005515 kernel: e820: update [mem 0x00000000-0x00000fff] usable ==> reserved
Jul 20 15:59:03 np0000005515 kernel: e820: remove [mem 0x000a0000-0x000fffff] usable
Jul 20 15:59:03 np0000005515 kernel: last_pfn = 0x680000 max_arch_pfn = 0x400000000
Jul 20 15:59:03 np0000005515 kernel: MTRR map: 4 entries (3 fixed + 1 variable; max 19), built from 8 variable MTRRs
Jul 20 15:59:03 np0000005515 kernel: x86/PAT: Configuration [0-7]: WB  WC  UC- UC  WB  WP  UC- WT  
Jul 20 15:59:03 np0000005515 kernel: last_pfn = 0x7ffdb max_arch_pfn = 0x400000000
Jul 20 15:59:03 np0000005515 kernel: found SMP MP-table at [mem 0x000f5380-0x000f538f]
Jul 20 15:59:03 np0000005515 kernel: Using GB pages for direct mapping
Jul 20 15:59:03 np0000005515 kernel: RAMDISK: [mem 0x344b1000-0x3624ffff]
Jul 20 15:59:03 np0000005515 kernel: ACPI: Early table checksum verification disabled
Jul 20 15:59:03 np0000005515 kernel: ACPI: RSDP 0x00000000000F5340 000014 (v00 BOCHS )
Jul 20 15:59:03 np0000005515 kernel: ACPI: RSDT 0x000000007FFE3A75 000034 (v01 BOCHS  BXPC     00000001 BXPC 00000001)
Jul 20 15:59:03 np0000005515 kernel: ACPI: FACP 0x000000007FFE384D 0000F4 (v03 BOCHS  BXPC     00000001 BXPC 00000001)
Jul 20 15:59:03 np0000005515 kernel: ACPI: DSDT 0x000000007FFDFB00 003D4D (v01 BOCHS  BXPC     00000001 BXPC 00000001)
Jul 20 15:59:03 np0000005515 kernel: ACPI: FACS 0x000000007FFDFAC0 000040
Jul 20 15:59:03 np0000005515 kernel: ACPI: APIC 0x000000007FFE3941 0000D0 (v03 BOCHS  BXPC     00000001 BXPC 00000001)
Jul 20 15:59:03 np0000005515 kernel: ACPI: MCFG 0x000000007FFE3A11 00003C (v01 BOCHS  BXPC     00000001 BXPC 00000001)
Jul 20 15:59:03 np0000005515 kernel: ACPI: WAET 0x000000007FFE3A4D 000028 (v01 BOCHS  BXPC     00000001 BXPC 00000001)
Jul 20 15:59:03 np0000005515 kernel: ACPI: Reserving FACP table memory at [mem 0x7ffe384d-0x7ffe3940]
Jul 20 15:59:03 np0000005515 kernel: ACPI: Reserving DSDT table memory at [mem 0x7ffdfb00-0x7ffe384c]
Jul 20 15:59:03 np0000005515 kernel: ACPI: Reserving FACS table memory at [mem 0x7ffdfac0-0x7ffdfaff]
Jul 20 15:59:03 np0000005515 kernel: ACPI: Reserving APIC table memory at [mem 0x7ffe3941-0x7ffe3a10]
Jul 20 15:59:03 np0000005515 kernel: ACPI: Reserving MCFG table memory at [mem 0x7ffe3a11-0x7ffe3a4c]
Jul 20 15:59:03 np0000005515 kernel: ACPI: Reserving WAET table memory at [mem 0x7ffe3a4d-0x7ffe3a74]
Jul 20 15:59:03 np0000005515 kernel: No NUMA configuration found
Jul 20 15:59:03 np0000005515 kernel: Faking a node at [mem 0x0000000000000000-0x000000067fffffff]
Jul 20 15:59:03 np0000005515 kernel: NODE_DATA(0) allocated [mem 0x67ffd5000-0x67fffffff]
Jul 20 15:59:03 np0000005515 kernel: crashkernel reserved: 0x000000003f000000 - 0x000000007f000000 (1024 MB)
Jul 20 15:59:03 np0000005515 kernel: Zone ranges:
Jul 20 15:59:03 np0000005515 kernel:   DMA      [mem 0x0000000000001000-0x0000000000ffffff]
Jul 20 15:59:03 np0000005515 kernel:   DMA32    [mem 0x0000000001000000-0x00000000ffffffff]
Jul 20 15:59:03 np0000005515 kernel:   Normal   [mem 0x0000000100000000-0x000000067fffffff]
Jul 20 15:59:03 np0000005515 kernel:   Device   empty
Jul 20 15:59:03 np0000005515 kernel: Movable zone start for each node
Jul 20 15:59:03 np0000005515 kernel: Early memory node ranges
Jul 20 15:59:03 np0000005515 kernel:   node   0: [mem 0x0000000000001000-0x000000000009efff]
Jul 20 15:59:03 np0000005515 kernel:   node   0: [mem 0x0000000000100000-0x000000007ffdafff]
Jul 20 15:59:03 np0000005515 kernel:   node   0: [mem 0x0000000100000000-0x000000067fffffff]
Jul 20 15:59:03 np0000005515 kernel: Initmem setup node 0 [mem 0x0000000000001000-0x000000067fffffff]
Jul 20 15:59:03 np0000005515 kernel: On node 0, zone DMA: 1 pages in unavailable ranges
Jul 20 15:59:03 np0000005515 kernel: On node 0, zone DMA: 97 pages in unavailable ranges
Jul 20 15:59:03 np0000005515 kernel: On node 0, zone Normal: 37 pages in unavailable ranges
Jul 20 15:59:03 np0000005515 kernel: ACPI: PM-Timer IO Port: 0x608
Jul 20 15:59:03 np0000005515 kernel: ACPI: LAPIC_NMI (acpi_id[0xff] dfl dfl lint[0x1])
Jul 20 15:59:03 np0000005515 kernel: IOAPIC[0]: apic_id 0, version 17, address 0xfec00000, GSI 0-23
Jul 20 15:59:03 np0000005515 kernel: ACPI: INT_SRC_OVR (bus 0 bus_irq 0 global_irq 2 dfl dfl)
Jul 20 15:59:03 np0000005515 kernel: ACPI: INT_SRC_OVR (bus 0 bus_irq 5 global_irq 5 high level)
Jul 20 15:59:03 np0000005515 kernel: ACPI: INT_SRC_OVR (bus 0 bus_irq 9 global_irq 9 high level)
Jul 20 15:59:03 np0000005515 kernel: ACPI: INT_SRC_OVR (bus 0 bus_irq 10 global_irq 10 high level)
Jul 20 15:59:03 np0000005515 kernel: ACPI: INT_SRC_OVR (bus 0 bus_irq 11 global_irq 11 high level)
Jul 20 15:59:03 np0000005515 kernel: ACPI: Using ACPI (MADT) for SMP configuration information
Jul 20 15:59:03 np0000005515 kernel: TSC deadline timer available
Jul 20 15:59:03 np0000005515 kernel: smpboot: Allowing 12 CPUs, 0 hotplug CPUs
Jul 20 15:59:03 np0000005515 kernel: kvm-guest: APIC: eoi() replaced with kvm_guest_apic_eoi_write()
Jul 20 15:59:03 np0000005515 kernel: PM: hibernation: Registered nosave memory: [mem 0x00000000-0x00000fff]
Jul 20 15:59:03 np0000005515 kernel: PM: hibernation: Registered nosave memory: [mem 0x0009f000-0x000fffff]
Jul 20 15:59:03 np0000005515 kernel: PM: hibernation: Registered nosave memory: [mem 0x7ffdb000-0xffffffff]
Jul 20 15:59:03 np0000005515 kernel: [mem 0xc0000000-0xfed1bfff] available for PCI devices
Jul 20 15:59:03 np0000005515 kernel: Booting paravirtualized kernel on KVM
Jul 20 15:59:03 np0000005515 kernel: clocksource: refined-jiffies: mask: 0xffffffff max_cycles: 0xffffffff, max_idle_ns: 1910969940391419 ns
Jul 20 15:59:03 np0000005515 kernel: setup_percpu: NR_CPUS:8192 nr_cpumask_bits:12 nr_cpu_ids:12 nr_node_ids:1
Jul 20 15:59:03 np0000005515 kernel: percpu: Embedded 86 pages/cpu s229376 r8192 d114688 u524288
Jul 20 15:59:03 np0000005515 kernel: pcpu-alloc: s229376 r8192 d114688 u524288 alloc=1*2097152
Jul 20 15:59:03 np0000005515 kernel: pcpu-alloc: [0] 00 01 02 03 [0] 04 05 06 07 
Jul 20 15:59:03 np0000005515 kernel: pcpu-alloc: [0] 08 09 10 11 
Jul 20 15:59:03 np0000005515 kernel: kvm-guest: PV spinlocks disabled, no host support
Jul 20 15:59:03 np0000005515 kernel: Kernel command line: BOOT_IMAGE=/vmlinuz-6.8.0-136-generic root=UUID=8515de1c-ba7e-467b-adde-6d9f8a8dbc1f ro amd_pstate=guided nomodeset vga=normal libata.fua=1 i915.modeset=0 nofb video=vesafb:off systemd.legacy_systemd_cgroup_controller=1 swapaccount=1 usbcore.autosuspend=-1 systemd.unified_cgroup_hierarchy=0 console=tty1 console=ttyS0 crashkernel=1024M
Jul 20 15:59:03 np0000005515 kernel: Booted with the nomodeset parameter. Only the system framebuffer will be available
Jul 20 15:59:03 np0000005515 kernel: Unknown kernel command line parameters "nofb vga=normal", will be passed to user space.
Jul 20 15:59:03 np0000005515 kernel: random: crng init done
Jul 20 15:59:03 np0000005515 kernel: Dentry cache hash table entries: 4194304 (order: 13, 33554432 bytes, linear)
Jul 20 15:59:03 np0000005515 kernel: Inode-cache hash table entries: 2097152 (order: 12, 16777216 bytes, linear)
Jul 20 15:59:03 np0000005515 kernel: Fallback order for Node 0: 0 
Jul 20 15:59:03 np0000005515 kernel: Built 1 zonelists, mobility grouping on.  Total pages: 6192859
Jul 20 15:59:03 np0000005515 kernel: Policy zone: Normal
Jul 20 15:59:03 np0000005515 kernel: mem auto-init: stack:all(zero), heap alloc:on, heap free:off
Jul 20 15:59:03 np0000005515 kernel: software IO TLB: area num 16.
Jul 20 15:59:03 np0000005515 kernel: Memory: 23519040K/25165284K available (22528K kernel code, 4441K rwdata, 14428K rodata, 4932K init, 4776K bss, 1645984K reserved, 0K cma-reserved)
Jul 20 15:59:03 np0000005515 kernel: SLUB: HWalign=64, Order=0-3, MinObjects=0, CPUs=12, Nodes=1
Jul 20 15:59:03 np0000005515 kernel: ftrace: allocating 58332 entries in 228 pages
Jul 20 15:59:03 np0000005515 kernel: ftrace: allocated 228 pages with 4 groups
Jul 20 15:59:03 np0000005515 kernel: Dynamic Preempt: voluntary
Jul 20 15:59:03 np0000005515 kernel: rcu: Preemptible hierarchical RCU implementation.
Jul 20 15:59:03 np0000005515 kernel: rcu:         RCU restricting CPUs from NR_CPUS=8192 to nr_cpu_ids=12.
Jul 20 15:59:03 np0000005515 kernel:         Trampoline variant of Tasks RCU enabled.
Jul 20 15:59:03 np0000005515 kernel:         Rude variant of Tasks RCU enabled.
Jul 20 15:59:03 np0000005515 kernel:         Tracing variant of Tasks RCU enabled.
Jul 20 15:59:03 np0000005515 kernel: rcu: RCU calculated value of scheduler-enlistment delay is 100 jiffies.
Jul 20 15:59:03 np0000005515 kernel: rcu: Adjusting geometry for rcu_fanout_leaf=16, nr_cpu_ids=12
Jul 20 15:59:03 np0000005515 kernel: RCU Tasks: Setting shift to 4 and lim to 1 rcu_task_cb_adjust=1 rcu_task_cpu_ids=12.
Jul 20 15:59:03 np0000005515 kernel: RCU Tasks Rude: Setting shift to 4 and lim to 1 rcu_task_cb_adjust=1 rcu_task_cpu_ids=12.
Jul 20 15:59:03 np0000005515 kernel: RCU Tasks Trace: Setting shift to 4 and lim to 1 rcu_task_cb_adjust=1 rcu_task_cpu_ids=12.
Jul 20 15:59:03 np0000005515 kernel: NR_IRQS: 524544, nr_irqs: 520, preallocated irqs: 16
Jul 20 15:59:03 np0000005515 kernel: rcu: srcu_init: Setting srcu_struct sizes based on contention.
Jul 20 15:59:03 np0000005515 kernel: Console: colour VGA+ 80x25
Jul 20 15:59:03 np0000005515 kernel: printk: legacy console [tty1] enabled
Jul 20 15:59:03 np0000005515 kernel: printk: legacy console [ttyS0] enabled
Jul 20 15:59:03 np0000005515 kernel: ACPI: Core revision 20230628
Jul 20 15:59:03 np0000005515 kernel: APIC: Switch to symmetric I/O mode setup
Jul 20 15:59:03 np0000005515 kernel: x2apic enabled
Jul 20 15:59:03 np0000005515 kernel: APIC: Switched APIC routing to: physical x2apic
Jul 20 15:59:03 np0000005515 kernel: tsc: Marking TSC unstable due to TSCs unsynchronized
Jul 20 15:59:03 np0000005515 kernel: Calibrating delay loop (skipped) preset value.. 4790.99 BogoMIPS (lpj=2395498)
Jul 20 15:59:03 np0000005515 kernel: x86/cpu: User Mode Instruction Prevention (UMIP) activated
Jul 20 15:59:03 np0000005515 kernel: Last level iTLB entries: 4KB 512, 2MB 255, 4MB 127
Jul 20 15:59:03 np0000005515 kernel: Last level dTLB entries: 4KB 512, 2MB 255, 4MB 127, 1GB 0
Jul 20 15:59:03 np0000005515 kernel: Spectre V1 : Mitigation: usercopy/swapgs barriers and __user pointer sanitization
Jul 20 15:59:03 np0000005515 kernel: Spectre V2 : Mitigation: Retpolines
Jul 20 15:59:03 np0000005515 kernel: Spectre V2 : Spectre v2 / SpectreRSB: Filling RSB on context switch and VMEXIT
Jul 20 15:59:03 np0000005515 kernel: Spectre V2 : Enabling Restricted Speculation for firmware calls
Jul 20 15:59:03 np0000005515 kernel: Spectre V2 : mitigation: Enabling conditional Indirect Branch Prediction Barrier
Jul 20 15:59:03 np0000005515 kernel: Speculative Store Bypass: Mitigation: Speculative Store Bypass disabled via prctl
Jul 20 15:59:03 np0000005515 kernel: Speculative Return Stack Overflow: IBPB-extending microcode not applied!
Jul 20 15:59:03 np0000005515 kernel: Speculative Return Stack Overflow: WARNING: See https://kernel.org/doc/html/latest/admin-guide/hw-vuln/srso.html for mitigation options.
Jul 20 15:59:03 np0000005515 kernel: active return thunk: srso_alias_return_thunk
Jul 20 15:59:03 np0000005515 kernel: Speculative Return Stack Overflow: Vulnerable: Safe RET, no microcode
Jul 20 15:59:03 np0000005515 kernel: Transient Scheduler Attacks: Forcing mitigation on in a VM
Jul 20 15:59:03 np0000005515 kernel: Transient Scheduler Attacks: Vulnerable: Clear CPU buffers attempted, no microcode
Jul 20 15:59:03 np0000005515 kernel: x86/fpu: Supporting XSAVE feature 0x001: 'x87 floating point registers'
Jul 20 15:59:03 np0000005515 kernel: x86/fpu: Supporting XSAVE feature 0x002: 'SSE registers'
Jul 20 15:59:03 np0000005515 kernel: x86/fpu: Supporting XSAVE feature 0x004: 'AVX registers'
Jul 20 15:59:03 np0000005515 kernel: x86/fpu: Supporting XSAVE feature 0x200: 'Protection Keys User registers'
Jul 20 15:59:03 np0000005515 kernel: x86/fpu: xstate_offset[2]:  576, xstate_sizes[2]:  256
Jul 20 15:59:03 np0000005515 kernel: x86/fpu: xstate_offset[9]:  832, xstate_sizes[9]:    8
Jul 20 15:59:03 np0000005515 kernel: x86/fpu: Enabled xstate features 0x207, context size is 840 bytes, using 'compacted' format.
Jul 20 15:59:03 np0000005515 kernel: Freeing SMP alternatives memory: 48K
Jul 20 15:59:03 np0000005515 kernel: pid_max: default: 32768 minimum: 301
Jul 20 15:59:03 np0000005515 kernel: LSM: initializing lsm=lockdown,capability,landlock,yama,apparmor,integrity
Jul 20 15:59:03 np0000005515 kernel: landlock: Up and running.
Jul 20 15:59:03 np0000005515 kernel: Yama: becoming mindful.
Jul 20 15:59:03 np0000005515 kernel: AppArmor: AppArmor initialized
Jul 20 15:59:03 np0000005515 kernel: Mount-cache hash table entries: 65536 (order: 7, 524288 bytes, linear)
Jul 20 15:59:03 np0000005515 kernel: Mountpoint-cache hash table entries: 65536 (order: 7, 524288 bytes, linear)
Jul 20 15:59:03 np0000005515 kernel: smpboot: CPU0: AMD EPYC-Milan Processor (family: 0x19, model: 0x1, stepping: 0x1)
Jul 20 15:59:03 np0000005515 kernel: Performance Events: Fam17h+ core perfctr, AMD PMU driver.
Jul 20 15:59:03 np0000005515 kernel: ... version:                0
Jul 20 15:59:03 np0000005515 kernel: ... bit width:              48
Jul 20 15:59:03 np0000005515 kernel: ... generic registers:      6
Jul 20 15:59:03 np0000005515 kernel: ... value mask:             0000ffffffffffff
Jul 20 15:59:03 np0000005515 kernel: ... max period:             00007fffffffffff
Jul 20 15:59:03 np0000005515 kernel: ... fixed-purpose events:   0
Jul 20 15:59:03 np0000005515 kernel: ... event mask:             000000000000003f
Jul 20 15:59:03 np0000005515 kernel: signal: max sigframe size: 3376
Jul 20 15:59:03 np0000005515 kernel: rcu: Hierarchical SRCU implementation.
Jul 20 15:59:03 np0000005515 kernel: rcu:         Max phase no-delay instances is 400.
Jul 20 15:59:03 np0000005515 kernel: smp: Bringing up secondary CPUs ...
Jul 20 15:59:03 np0000005515 kernel: smpboot: x86: Booting SMP configuration:
Jul 20 15:59:03 np0000005515 kernel: .... node  #0, CPUs:        #1  #2  #3  #4  #5  #6  #7  #8  #9 #10 #11
Jul 20 15:59:03 np0000005515 kernel: smp: Brought up 1 node, 12 CPUs
Jul 20 15:59:03 np0000005515 kernel: smpboot: Max logical packages: 12
Jul 20 15:59:03 np0000005515 kernel: smpboot: Total of 12 processors activated (57491.95 BogoMIPS)
Jul 20 15:59:03 np0000005515 kernel: devtmpfs: initialized
Jul 20 15:59:03 np0000005515 kernel: x86/mm: Memory block size: 128MB
Jul 20 15:59:03 np0000005515 kernel: clocksource: jiffies: mask: 0xffffffff max_cycles: 0xffffffff, max_idle_ns: 1911260446275000 ns
Jul 20 15:59:03 np0000005515 kernel: futex hash table entries: 4096 (order: 6, 262144 bytes, linear)
Jul 20 15:59:03 np0000005515 kernel: pinctrl core: initialized pinctrl subsystem
Jul 20 15:59:03 np0000005515 kernel: PM: RTC time: 15:59:00, date: 2026-07-20
Jul 20 15:59:03 np0000005515 kernel: NET: Registered PF_NETLINK/PF_ROUTE protocol family
Jul 20 15:59:03 np0000005515 kernel: DMA: preallocated 4096 KiB GFP_KERNEL pool for atomic allocations
Jul 20 15:59:03 np0000005515 kernel: DMA: preallocated 4096 KiB GFP_KERNEL|GFP_DMA pool for atomic allocations
Jul 20 15:59:03 np0000005515 kernel: DMA: preallocated 4096 KiB GFP_KERNEL|GFP_DMA32 pool for atomic allocations
Jul 20 15:59:03 np0000005515 kernel: audit: initializing netlink subsys (disabled)
Jul 20 15:59:03 np0000005515 kernel: audit: type=2000 audit(1784563140.753:1): state=initialized audit_enabled=0 res=1
Jul 20 15:59:03 np0000005515 kernel: thermal_sys: Registered thermal governor 'fair_share'
Jul 20 15:59:03 np0000005515 kernel: thermal_sys: Registered thermal governor 'bang_bang'
Jul 20 15:59:03 np0000005515 kernel: thermal_sys: Registered thermal governor 'step_wise'
Jul 20 15:59:03 np0000005515 kernel: thermal_sys: Registered thermal governor 'user_space'
Jul 20 15:59:03 np0000005515 kernel: thermal_sys: Registered thermal governor 'power_allocator'
Jul 20 15:59:03 np0000005515 kernel: cpuidle: using governor ladder
Jul 20 15:59:03 np0000005515 kernel: cpuidle: using governor menu
Jul 20 15:59:03 np0000005515 kernel: acpiphp: ACPI Hot Plug PCI Controller Driver version: 0.5
Jul 20 15:59:03 np0000005515 kernel: PCI: ECAM [mem 0xb0000000-0xbfffffff] (base 0xb0000000) for domain 0000 [bus 00-ff]
Jul 20 15:59:03 np0000005515 kernel: PCI: ECAM [mem 0xb0000000-0xbfffffff] reserved as E820 entry
Jul 20 15:59:03 np0000005515 kernel: PCI: Using configuration type 1 for base access
Jul 20 15:59:03 np0000005515 kernel: kprobes: kprobe jump-optimization is enabled. All kprobes are optimized if possible.
Jul 20 15:59:03 np0000005515 kernel: HugeTLB: registered 1.00 GiB page size, pre-allocated 0 pages
Jul 20 15:59:03 np0000005515 kernel: HugeTLB: 16380 KiB vmemmap can be freed for a 1.00 GiB page
Jul 20 15:59:03 np0000005515 kernel: HugeTLB: registered 2.00 MiB page size, pre-allocated 0 pages
Jul 20 15:59:03 np0000005515 kernel: HugeTLB: 28 KiB vmemmap can be freed for a 2.00 MiB page
Jul 20 15:59:03 np0000005515 kernel: ACPI: Added _OSI(Module Device)
Jul 20 15:59:03 np0000005515 kernel: ACPI: Added _OSI(Processor Device)
Jul 20 15:59:03 np0000005515 kernel: ACPI: Added _OSI(Processor Aggregator Device)
Jul 20 15:59:03 np0000005515 kernel: ACPI: 1 ACPI AML tables successfully acquired and loaded
Jul 20 15:59:03 np0000005515 kernel: ACPI: _OSC evaluation for CPUs failed, trying _PDC
Jul 20 15:59:03 np0000005515 kernel: ACPI: Interpreter enabled
Jul 20 15:59:03 np0000005515 kernel: ACPI: PM: (supports S0 S3 S4 S5)
Jul 20 15:59:03 np0000005515 kernel: ACPI: Using IOAPIC for interrupt routing
Jul 20 15:59:03 np0000005515 kernel: PCI: Using host bridge windows from ACPI; if necessary, use "pci=nocrs" and report a bug
Jul 20 15:59:03 np0000005515 kernel: PCI: Using E820 reservations for host bridge windows
Jul 20 15:59:03 np0000005515 kernel: ACPI: Enabled 2 GPEs in block 00 to 3F
Jul 20 15:59:03 np0000005515 kernel: ACPI: PCI Root Bridge [PCI0] (domain 0000 [bus 00-ff])
Jul 20 15:59:03 np0000005515 kernel: acpi PNP0A08:00: _OSC: OS supports [ExtendedConfig ASPM ClockPM Segments MSI EDR HPX-Type3]
Jul 20 15:59:03 np0000005515 kernel: acpi PNP0A08:00: _OSC: platform does not support [PCIeHotplug LTR DPC]
Jul 20 15:59:03 np0000005515 kernel: acpi PNP0A08:00: _OSC: OS now controls [SHPCHotplug PME AER PCIeCapability]
Jul 20 15:59:03 np0000005515 kernel: PCI host bridge to bus 0000:00
Jul 20 15:59:03 np0000005515 kernel: pci_bus 0000:00: root bus resource [io  0x0000-0x0cf7 window]
Jul 20 15:59:03 np0000005515 kernel: pci_bus 0000:00: root bus resource [io  0x0d00-0xffff window]
Jul 20 15:59:03 np0000005515 kernel: pci_bus 0000:00: root bus resource [mem 0x000a0000-0x000bffff window]
Jul 20 15:59:03 np0000005515 kernel: pci_bus 0000:00: root bus resource [mem 0x80000000-0xafffffff window]
Jul 20 15:59:03 np0000005515 kernel: pci_bus 0000:00: root bus resource [mem 0xc0000000-0xfebfffff window]
Jul 20 15:59:03 np0000005515 kernel: pci_bus 0000:00: root bus resource [mem 0xc000000000-0xc7ffffffff window]
Jul 20 15:59:03 np0000005515 kernel: pci_bus 0000:00: root bus resource [bus 00-ff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:00.0: [8086:29c0] type 00 class 0x060000 conventional PCI endpoint
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:01.0: [1af4:1050] type 00 class 0x030000 conventional PCI endpoint
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:01.0: BAR 0 [mem 0xfb800000-0xfbffffff pref]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:01.0: BAR 2 [mem 0xc220000000-0xc220003fff 64bit pref]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:01.0: BAR 4 [mem 0xfea10000-0xfea10fff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:01.0: ROM [mem 0xfea00000-0xfea0ffff pref]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:01.0: Video device with shadowed ROM at [mem 0x000c0000-0x000dffff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.0: [1b36:000c] type 01 class 0x060400 PCIe Root Port
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.0: BAR 0 [mem 0xfea11000-0xfea11fff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.0: PCI bridge to [bus 01-02]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.0:   bridge window [io  0xc000-0xcfff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.0:   bridge window [mem 0xfc600000-0xfc9fffff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.0:   bridge window [mem 0xc200000000-0xc21fffffff 64bit pref]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.1: [1b36:000c] type 01 class 0x060400 PCIe Root Port
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.1: BAR 0 [mem 0xfea12000-0xfea12fff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.1: PCI bridge to [bus 03]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.1:   bridge window [mem 0xfe800000-0xfe9fffff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.1:   bridge window [mem 0xc1e0000000-0xc1ffffffff 64bit pref]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.2: [1b36:000c] type 01 class 0x060400 PCIe Root Port
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.2: BAR 0 [mem 0xfea13000-0xfea13fff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.2: PCI bridge to [bus 04]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.2:   bridge window [mem 0xfe600000-0xfe7fffff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.2:   bridge window [mem 0xc1c0000000-0xc1dfffffff 64bit pref]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.3: [1b36:000c] type 01 class 0x060400 PCIe Root Port
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.3: BAR 0 [mem 0xfea14000-0xfea14fff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.3: PCI bridge to [bus 05]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.3:   bridge window [mem 0xfe400000-0xfe5fffff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.3:   bridge window [mem 0xc1a0000000-0xc1bfffffff 64bit pref]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.4: [1b36:000c] type 01 class 0x060400 PCIe Root Port
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.4: BAR 0 [mem 0xfea15000-0xfea15fff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.4: PCI bridge to [bus 06]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.4:   bridge window [mem 0xfe200000-0xfe3fffff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.4:   bridge window [mem 0xc180000000-0xc19fffffff 64bit pref]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.5: [1b36:000c] type 01 class 0x060400 PCIe Root Port
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.5: BAR 0 [mem 0xfea16000-0xfea16fff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.5: PCI bridge to [bus 07]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.5:   bridge window [mem 0xfe000000-0xfe1fffff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.5:   bridge window [mem 0xc160000000-0xc17fffffff 64bit pref]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.6: [1b36:000c] type 01 class 0x060400 PCIe Root Port
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.6: BAR 0 [mem 0xfea17000-0xfea17fff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.6: PCI bridge to [bus 08]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.6:   bridge window [mem 0xfde00000-0xfdffffff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.6:   bridge window [mem 0xc140000000-0xc15fffffff 64bit pref]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.7: [1b36:000c] type 01 class 0x060400 PCIe Root Port
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.7: BAR 0 [mem 0xfea18000-0xfea18fff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.7: PCI bridge to [bus 09]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.7:   bridge window [mem 0xfdc00000-0xfddfffff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.7:   bridge window [mem 0xc120000000-0xc13fffffff 64bit pref]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.0: [1b36:000c] type 01 class 0x060400 PCIe Root Port
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.0: BAR 0 [mem 0xfea19000-0xfea19fff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.0: PCI bridge to [bus 0a]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.0:   bridge window [mem 0xfda00000-0xfdbfffff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.0:   bridge window [mem 0xc100000000-0xc11fffffff 64bit pref]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.1: [1b36:000c] type 01 class 0x060400 PCIe Root Port
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.1: BAR 0 [mem 0xfea1a000-0xfea1afff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.1: PCI bridge to [bus 0b]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.1:   bridge window [mem 0xfd800000-0xfd9fffff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.1:   bridge window [mem 0xc0e0000000-0xc0ffffffff 64bit pref]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.2: [1b36:000c] type 01 class 0x060400 PCIe Root Port
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.2: BAR 0 [mem 0xfea1b000-0xfea1bfff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.2: PCI bridge to [bus 0c]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.2:   bridge window [mem 0xfd600000-0xfd7fffff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.2:   bridge window [mem 0xc0c0000000-0xc0dfffffff 64bit pref]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.3: [1b36:000c] type 01 class 0x060400 PCIe Root Port
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.3: BAR 0 [mem 0xfea1c000-0xfea1cfff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.3: PCI bridge to [bus 0d]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.3:   bridge window [mem 0xfd400000-0xfd5fffff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.3:   bridge window [mem 0xc0a0000000-0xc0bfffffff 64bit pref]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.4: [1b36:000c] type 01 class 0x060400 PCIe Root Port
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.4: BAR 0 [mem 0xfea1d000-0xfea1dfff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.4: PCI bridge to [bus 0e]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.4:   bridge window [mem 0xfd200000-0xfd3fffff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.4:   bridge window [mem 0xc080000000-0xc09fffffff 64bit pref]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.5: [1b36:000c] type 01 class 0x060400 PCIe Root Port
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.5: BAR 0 [mem 0xfea1e000-0xfea1efff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.5: PCI bridge to [bus 0f]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.5:   bridge window [mem 0xfd000000-0xfd1fffff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.5:   bridge window [mem 0xc060000000-0xc07fffffff 64bit pref]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.6: [1b36:000c] type 01 class 0x060400 PCIe Root Port
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.6: BAR 0 [mem 0xfea1f000-0xfea1ffff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.6: PCI bridge to [bus 10]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.6:   bridge window [mem 0xfce00000-0xfcffffff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.6:   bridge window [mem 0xc040000000-0xc05fffffff 64bit pref]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.7: [1b36:000c] type 01 class 0x060400 PCIe Root Port
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.7: BAR 0 [mem 0xfea20000-0xfea20fff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.7: PCI bridge to [bus 11]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.7:   bridge window [mem 0xfcc00000-0xfcdfffff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.7:   bridge window [mem 0xc020000000-0xc03fffffff 64bit pref]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:04.0: [1b36:000c] type 01 class 0x060400 PCIe Root Port
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:04.0: BAR 0 [mem 0xfea21000-0xfea21fff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:04.0: PCI bridge to [bus 12]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:04.0:   bridge window [mem 0xfca00000-0xfcbfffff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:04.0:   bridge window [mem 0xc000000000-0xc01fffffff 64bit pref]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:1f.0: [8086:2918] type 00 class 0x060100 conventional PCI endpoint
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:1f.0: quirk: [io  0x0600-0x067f] claimed by ICH6 ACPI/GPIO/TCO
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:1f.2: [8086:2922] type 00 class 0x010601 conventional PCI endpoint
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:1f.2: BAR 4 [io  0xd040-0xd05f]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:1f.2: BAR 5 [mem 0xfea22000-0xfea22fff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:1f.3: [8086:2930] type 00 class 0x0c0500 conventional PCI endpoint
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:1f.3: BAR 4 [io  0x0700-0x073f]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:01:00.0: [1b36:000e] type 01 class 0x060400 PCIe to PCI/PCI-X bridge
Jul 20 15:59:03 np0000005515 kernel: pci 0000:01:00.0: BAR 0 [mem 0xfc800000-0xfc8000ff 64bit]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:01:00.0: PCI bridge to [bus 02]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:01:00.0:   bridge window [io  0xc000-0xcfff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:01:00.0:   bridge window [mem 0xfc600000-0xfc7fffff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:01:00.0:   bridge window [mem 0xc200000000-0xc21fffffff 64bit pref]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.0: PCI bridge to [bus 01-02]
Jul 20 15:59:03 np0000005515 kernel: pci_bus 0000:02: extended config space not accessible
Jul 20 15:59:03 np0000005515 kernel: acpiphp: Slot [1] registered
Jul 20 15:59:03 np0000005515 kernel: acpiphp: Slot [0] registered
Jul 20 15:59:03 np0000005515 kernel: acpiphp: Slot [2] registered
Jul 20 15:59:03 np0000005515 kernel: acpiphp: Slot [3] registered
Jul 20 15:59:03 np0000005515 kernel: acpiphp: Slot [4] registered
Jul 20 15:59:03 np0000005515 kernel: acpiphp: Slot [5] registered
Jul 20 15:59:03 np0000005515 kernel: acpiphp: Slot [6] registered
Jul 20 15:59:03 np0000005515 kernel: acpiphp: Slot [7] registered
Jul 20 15:59:03 np0000005515 kernel: acpiphp: Slot [8] registered
Jul 20 15:59:03 np0000005515 kernel: acpiphp: Slot [9] registered
Jul 20 15:59:03 np0000005515 kernel: acpiphp: Slot [10] registered
Jul 20 15:59:03 np0000005515 kernel: acpiphp: Slot [11] registered
Jul 20 15:59:03 np0000005515 kernel: acpiphp: Slot [12] registered
Jul 20 15:59:03 np0000005515 kernel: acpiphp: Slot [13] registered
Jul 20 15:59:03 np0000005515 kernel: acpiphp: Slot [14] registered
Jul 20 15:59:03 np0000005515 kernel: acpiphp: Slot [15] registered
Jul 20 15:59:03 np0000005515 kernel: acpiphp: Slot [16] registered
Jul 20 15:59:03 np0000005515 kernel: acpiphp: Slot [17] registered
Jul 20 15:59:03 np0000005515 kernel: acpiphp: Slot [18] registered
Jul 20 15:59:03 np0000005515 kernel: acpiphp: Slot [19] registered
Jul 20 15:59:03 np0000005515 kernel: acpiphp: Slot [20] registered
Jul 20 15:59:03 np0000005515 kernel: acpiphp: Slot [21] registered
Jul 20 15:59:03 np0000005515 kernel: acpiphp: Slot [22] registered
Jul 20 15:59:03 np0000005515 kernel: acpiphp: Slot [23] registered
Jul 20 15:59:03 np0000005515 kernel: acpiphp: Slot [24] registered
Jul 20 15:59:03 np0000005515 kernel: acpiphp: Slot [25] registered
Jul 20 15:59:03 np0000005515 kernel: acpiphp: Slot [26] registered
Jul 20 15:59:03 np0000005515 kernel: acpiphp: Slot [27] registered
Jul 20 15:59:03 np0000005515 kernel: acpiphp: Slot [28] registered
Jul 20 15:59:03 np0000005515 kernel: acpiphp: Slot [29] registered
Jul 20 15:59:03 np0000005515 kernel: acpiphp: Slot [30] registered
Jul 20 15:59:03 np0000005515 kernel: acpiphp: Slot [31] registered
Jul 20 15:59:03 np0000005515 kernel: pci 0000:02:01.0: [8086:7020] type 00 class 0x0c0300 conventional PCI endpoint
Jul 20 15:59:03 np0000005515 kernel: pci 0000:02:01.0: BAR 4 [io  0xc000-0xc01f]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:01:00.0: PCI bridge to [bus 02]
Jul 20 15:59:03 np0000005515 kernel: acpiphp: Slot [0-2] registered
Jul 20 15:59:03 np0000005515 kernel: pci 0000:03:00.0: [1af4:1041] type 00 class 0x020000 PCIe Endpoint
Jul 20 15:59:03 np0000005515 kernel: pci 0000:03:00.0: BAR 1 [mem 0xfe880000-0xfe880fff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:03:00.0: BAR 4 [mem 0xc1e0000000-0xc1e0003fff 64bit pref]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:03:00.0: ROM [mem 0xfe800000-0xfe87ffff pref]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.1: PCI bridge to [bus 03]
Jul 20 15:59:03 np0000005515 kernel: acpiphp: Slot [0-3] registered
Jul 20 15:59:03 np0000005515 kernel: pci 0000:04:00.0: [1af4:1048] type 00 class 0x010000 PCIe Endpoint
Jul 20 15:59:03 np0000005515 kernel: pci 0000:04:00.0: BAR 1 [mem 0xfe600000-0xfe600fff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:04:00.0: BAR 4 [mem 0xc1c0000000-0xc1c0003fff 64bit pref]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.2: PCI bridge to [bus 04]
Jul 20 15:59:03 np0000005515 kernel: acpiphp: Slot [0-4] registered
Jul 20 15:59:03 np0000005515 kernel: pci 0000:05:00.0: [1af4:1045] type 00 class 0x00ff00 PCIe Endpoint
Jul 20 15:59:03 np0000005515 kernel: pci 0000:05:00.0: BAR 4 [mem 0xc1a0000000-0xc1a0003fff 64bit pref]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.3: PCI bridge to [bus 05]
Jul 20 15:59:03 np0000005515 kernel: acpiphp: Slot [0-5] registered
Jul 20 15:59:03 np0000005515 kernel: pci 0000:06:00.0: [1af4:1044] type 00 class 0x00ff00 PCIe Endpoint
Jul 20 15:59:03 np0000005515 kernel: pci 0000:06:00.0: BAR 1 [mem 0xfe200000-0xfe200fff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:06:00.0: BAR 4 [mem 0xc180000000-0xc180003fff 64bit pref]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.4: PCI bridge to [bus 06]
Jul 20 15:59:03 np0000005515 kernel: acpiphp: Slot [0-6] registered
Jul 20 15:59:03 np0000005515 kernel: pci 0000:07:00.0: [1af4:1041] type 00 class 0x020000 PCIe Endpoint
Jul 20 15:59:03 np0000005515 kernel: pci 0000:07:00.0: BAR 1 [mem 0xfe080000-0xfe080fff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:07:00.0: BAR 4 [mem 0xc160000000-0xc160003fff 64bit pref]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:07:00.0: ROM [mem 0xfe000000-0xfe07ffff pref]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.5: PCI bridge to [bus 07]
Jul 20 15:59:03 np0000005515 kernel: acpiphp: Slot [0-7] registered
Jul 20 15:59:03 np0000005515 kernel: pci 0000:08:00.0: [1af4:1041] type 00 class 0x020000 PCIe Endpoint
Jul 20 15:59:03 np0000005515 kernel: pci 0000:08:00.0: BAR 1 [mem 0xfde80000-0xfde80fff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:08:00.0: BAR 4 [mem 0xc140000000-0xc140003fff 64bit pref]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:08:00.0: ROM [mem 0xfde00000-0xfde7ffff pref]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.6: PCI bridge to [bus 08]
Jul 20 15:59:03 np0000005515 kernel: acpiphp: Slot [0-8] registered
Jul 20 15:59:03 np0000005515 kernel: pci 0000:09:00.0: [1af4:1041] type 00 class 0x020000 PCIe Endpoint
Jul 20 15:59:03 np0000005515 kernel: pci 0000:09:00.0: BAR 1 [mem 0xfdc80000-0xfdc80fff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:09:00.0: BAR 4 [mem 0xc120000000-0xc120003fff 64bit pref]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:09:00.0: ROM [mem 0xfdc00000-0xfdc7ffff pref]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.7: PCI bridge to [bus 09]
Jul 20 15:59:03 np0000005515 kernel: acpiphp: Slot [0-9] registered
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.0: PCI bridge to [bus 0a]
Jul 20 15:59:03 np0000005515 kernel: acpiphp: Slot [0-10] registered
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.1: PCI bridge to [bus 0b]
Jul 20 15:59:03 np0000005515 kernel: acpiphp: Slot [0-11] registered
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.2: PCI bridge to [bus 0c]
Jul 20 15:59:03 np0000005515 kernel: acpiphp: Slot [0-12] registered
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.3: PCI bridge to [bus 0d]
Jul 20 15:59:03 np0000005515 kernel: acpiphp: Slot [0-13] registered
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.4: PCI bridge to [bus 0e]
Jul 20 15:59:03 np0000005515 kernel: acpiphp: Slot [0-14] registered
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.5: PCI bridge to [bus 0f]
Jul 20 15:59:03 np0000005515 kernel: acpiphp: Slot [0-15] registered
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.6: PCI bridge to [bus 10]
Jul 20 15:59:03 np0000005515 kernel: acpiphp: Slot [0-16] registered
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.7: PCI bridge to [bus 11]
Jul 20 15:59:03 np0000005515 kernel: acpiphp: Slot [0-17] registered
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:04.0: PCI bridge to [bus 12]
Jul 20 15:59:03 np0000005515 kernel: ACPI: PCI: Interrupt link LNKA configured for IRQ 10
Jul 20 15:59:03 np0000005515 kernel: ACPI: PCI: Interrupt link LNKB configured for IRQ 10
Jul 20 15:59:03 np0000005515 kernel: ACPI: PCI: Interrupt link LNKC configured for IRQ 11
Jul 20 15:59:03 np0000005515 kernel: ACPI: PCI: Interrupt link LNKD configured for IRQ 11
Jul 20 15:59:03 np0000005515 kernel: ACPI: PCI: Interrupt link LNKE configured for IRQ 10
Jul 20 15:59:03 np0000005515 kernel: ACPI: PCI: Interrupt link LNKF configured for IRQ 10
Jul 20 15:59:03 np0000005515 kernel: ACPI: PCI: Interrupt link LNKG configured for IRQ 11
Jul 20 15:59:03 np0000005515 kernel: ACPI: PCI: Interrupt link LNKH configured for IRQ 11
Jul 20 15:59:03 np0000005515 kernel: ACPI: PCI: Interrupt link GSIA configured for IRQ 16
Jul 20 15:59:03 np0000005515 kernel: ACPI: PCI: Interrupt link GSIB configured for IRQ 17
Jul 20 15:59:03 np0000005515 kernel: ACPI: PCI: Interrupt link GSIC configured for IRQ 18
Jul 20 15:59:03 np0000005515 kernel: ACPI: PCI: Interrupt link GSID configured for IRQ 19
Jul 20 15:59:03 np0000005515 kernel: ACPI: PCI: Interrupt link GSIE configured for IRQ 20
Jul 20 15:59:03 np0000005515 kernel: ACPI: PCI: Interrupt link GSIF configured for IRQ 21
Jul 20 15:59:03 np0000005515 kernel: ACPI: PCI: Interrupt link GSIG configured for IRQ 22
Jul 20 15:59:03 np0000005515 kernel: ACPI: PCI: Interrupt link GSIH configured for IRQ 23
Jul 20 15:59:03 np0000005515 kernel: iommu: Default domain type: Translated
Jul 20 15:59:03 np0000005515 kernel: iommu: DMA domain TLB invalidation policy: lazy mode
Jul 20 15:59:03 np0000005515 kernel: SCSI subsystem initialized
Jul 20 15:59:03 np0000005515 kernel: libata version 3.00 loaded.
Jul 20 15:59:03 np0000005515 kernel: ACPI: bus type USB registered
Jul 20 15:59:03 np0000005515 kernel: usbcore: registered new interface driver usbfs
Jul 20 15:59:03 np0000005515 kernel: usbcore: registered new interface driver hub
Jul 20 15:59:03 np0000005515 kernel: usbcore: registered new device driver usb
Jul 20 15:59:03 np0000005515 kernel: pps_core: LinuxPPS API ver. 1 registered
Jul 20 15:59:03 np0000005515 kernel: pps_core: Software ver. 5.3.6 - Copyright 2005-2007 Rodolfo Giometti <giometti@linux.it>
Jul 20 15:59:03 np0000005515 kernel: PTP clock support registered
Jul 20 15:59:03 np0000005515 kernel: EDAC MC: Ver: 3.0.0
Jul 20 15:59:03 np0000005515 kernel: NetLabel: Initializing
Jul 20 15:59:03 np0000005515 kernel: NetLabel:  domain hash size = 128
Jul 20 15:59:03 np0000005515 kernel: NetLabel:  protocols = UNLABELED CIPSOv4 CALIPSO
Jul 20 15:59:03 np0000005515 kernel: NetLabel:  unlabeled traffic allowed by default
Jul 20 15:59:03 np0000005515 kernel: mctp: management component transport protocol core
Jul 20 15:59:03 np0000005515 kernel: NET: Registered PF_MCTP protocol family
Jul 20 15:59:03 np0000005515 kernel: PCI: Using ACPI for IRQ routing
Jul 20 15:59:03 np0000005515 kernel: PCI: pci_cache_line_size set to 64 bytes
Jul 20 15:59:03 np0000005515 kernel: e820: reserve RAM buffer [mem 0x0009fc00-0x0009ffff]
Jul 20 15:59:03 np0000005515 kernel: e820: reserve RAM buffer [mem 0x7ffdb000-0x7fffffff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:01.0: vgaarb: setting as boot VGA device
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:01.0: vgaarb: bridge control possible
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:01.0: vgaarb: VGA device added: decodes=io+mem,owns=io+mem,locks=none
Jul 20 15:59:03 np0000005515 kernel: vgaarb: loaded
Jul 20 15:59:03 np0000005515 kernel: clocksource: Switched to clocksource kvm-clock
Jul 20 15:59:03 np0000005515 kernel: VFS: Disk quotas dquot_6.6.0
Jul 20 15:59:03 np0000005515 kernel: VFS: Dquot-cache hash table entries: 512 (order 0, 4096 bytes)
Jul 20 15:59:03 np0000005515 kernel: AppArmor: AppArmor Filesystem Enabled
Jul 20 15:59:03 np0000005515 kernel: pnp: PnP ACPI init
Jul 20 15:59:03 np0000005515 kernel: system 00:04: [mem 0xb0000000-0xbfffffff window] has been reserved
Jul 20 15:59:03 np0000005515 kernel: pnp: PnP ACPI: found 5 devices
Jul 20 15:59:03 np0000005515 kernel: clocksource: acpi_pm: mask: 0xffffff max_cycles: 0xffffff, max_idle_ns: 2085701024 ns
Jul 20 15:59:03 np0000005515 kernel: NET: Registered PF_INET protocol family
Jul 20 15:59:03 np0000005515 kernel: IP idents hash table entries: 262144 (order: 9, 2097152 bytes, linear)
Jul 20 15:59:03 np0000005515 kernel: tcp_listen_portaddr_hash hash table entries: 16384 (order: 6, 262144 bytes, linear)
Jul 20 15:59:03 np0000005515 kernel: Table-perturb hash table entries: 65536 (order: 6, 262144 bytes, linear)
Jul 20 15:59:03 np0000005515 kernel: TCP established hash table entries: 262144 (order: 9, 2097152 bytes, linear)
Jul 20 15:59:03 np0000005515 kernel: TCP bind hash table entries: 65536 (order: 9, 2097152 bytes, linear)
Jul 20 15:59:03 np0000005515 kernel: TCP: Hash tables configured (established 262144 bind 65536)
Jul 20 15:59:03 np0000005515 kernel: MPTCP token hash table entries: 32768 (order: 8, 786432 bytes, linear)
Jul 20 15:59:03 np0000005515 kernel: UDP hash table entries: 16384 (order: 7, 524288 bytes, linear)
Jul 20 15:59:03 np0000005515 kernel: UDP-Lite hash table entries: 16384 (order: 7, 524288 bytes, linear)
Jul 20 15:59:03 np0000005515 kernel: NET: Registered PF_UNIX/PF_LOCAL protocol family
Jul 20 15:59:03 np0000005515 kernel: NET: Registered PF_XDP protocol family
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.1: bridge window [io  0x1000-0x0fff] to [bus 03] add_size 1000
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.2: bridge window [io  0x1000-0x0fff] to [bus 04] add_size 1000
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.3: bridge window [io  0x1000-0x0fff] to [bus 05] add_size 1000
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.4: bridge window [io  0x1000-0x0fff] to [bus 06] add_size 1000
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.5: bridge window [io  0x1000-0x0fff] to [bus 07] add_size 1000
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.6: bridge window [io  0x1000-0x0fff] to [bus 08] add_size 1000
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.7: bridge window [io  0x1000-0x0fff] to [bus 09] add_size 1000
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.0: bridge window [io  0x1000-0x0fff] to [bus 0a] add_size 1000
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.1: bridge window [io  0x1000-0x0fff] to [bus 0b] add_size 1000
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.2: bridge window [io  0x1000-0x0fff] to [bus 0c] add_size 1000
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.3: bridge window [io  0x1000-0x0fff] to [bus 0d] add_size 1000
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.4: bridge window [io  0x1000-0x0fff] to [bus 0e] add_size 1000
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.5: bridge window [io  0x1000-0x0fff] to [bus 0f] add_size 1000
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.6: bridge window [io  0x1000-0x0fff] to [bus 10] add_size 1000
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.7: bridge window [io  0x1000-0x0fff] to [bus 11] add_size 1000
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:04.0: bridge window [io  0x1000-0x0fff] to [bus 12] add_size 1000
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.1: bridge window [io  0x1000-0x1fff]: assigned
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.2: bridge window [io  0x2000-0x2fff]: assigned
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.3: bridge window [io  0x3000-0x3fff]: assigned
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.4: bridge window [io  0x4000-0x4fff]: assigned
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.5: bridge window [io  0x5000-0x5fff]: assigned
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.6: bridge window [io  0x6000-0x6fff]: assigned
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.7: bridge window [io  0x7000-0x7fff]: assigned
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.0: bridge window [io  0x8000-0x8fff]: assigned
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.1: bridge window [io  0x9000-0x9fff]: assigned
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.2: bridge window [io  0xa000-0xafff]: assigned
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.3: bridge window [io  0xb000-0xbfff]: assigned
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.4: bridge window [io  0xe000-0xefff]: assigned
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.5: bridge window [io  0xf000-0xffff]: assigned
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.6: bridge window [io  size 0x1000]: can't assign; no space
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.6: bridge window [io  size 0x1000]: failed to assign
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.7: bridge window [io  size 0x1000]: can't assign; no space
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.7: bridge window [io  size 0x1000]: failed to assign
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:04.0: bridge window [io  size 0x1000]: can't assign; no space
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:04.0: bridge window [io  size 0x1000]: failed to assign
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:04.0: bridge window [io  0x1000-0x1fff]: assigned
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.7: bridge window [io  0x2000-0x2fff]: assigned
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.6: bridge window [io  0x3000-0x3fff]: assigned
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.5: bridge window [io  0x4000-0x4fff]: assigned
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.4: bridge window [io  0x5000-0x5fff]: assigned
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.3: bridge window [io  0x6000-0x6fff]: assigned
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.2: bridge window [io  0x7000-0x7fff]: assigned
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.1: bridge window [io  0x8000-0x8fff]: assigned
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.0: bridge window [io  0x9000-0x9fff]: assigned
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.7: bridge window [io  0xa000-0xafff]: assigned
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.6: bridge window [io  0xb000-0xbfff]: assigned
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.5: bridge window [io  0xe000-0xefff]: assigned
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.4: bridge window [io  0xf000-0xffff]: assigned
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.3: bridge window [io  size 0x1000]: can't assign; no space
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.3: bridge window [io  size 0x1000]: failed to assign
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.2: bridge window [io  size 0x1000]: can't assign; no space
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.2: bridge window [io  size 0x1000]: failed to assign
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.1: bridge window [io  size 0x1000]: can't assign; no space
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.1: bridge window [io  size 0x1000]: failed to assign
Jul 20 15:59:03 np0000005515 kernel: pci 0000:01:00.0: PCI bridge to [bus 02]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:01:00.0:   bridge window [io  0xc000-0xcfff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:01:00.0:   bridge window [mem 0xfc600000-0xfc7fffff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:01:00.0:   bridge window [mem 0xc200000000-0xc21fffffff 64bit pref]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.0: PCI bridge to [bus 01-02]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.0:   bridge window [io  0xc000-0xcfff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.0:   bridge window [mem 0xfc600000-0xfc9fffff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.0:   bridge window [mem 0xc200000000-0xc21fffffff 64bit pref]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.1: PCI bridge to [bus 03]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.1:   bridge window [mem 0xfe800000-0xfe9fffff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.1:   bridge window [mem 0xc1e0000000-0xc1ffffffff 64bit pref]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.2: PCI bridge to [bus 04]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.2:   bridge window [mem 0xfe600000-0xfe7fffff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.2:   bridge window [mem 0xc1c0000000-0xc1dfffffff 64bit pref]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.3: PCI bridge to [bus 05]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.3:   bridge window [mem 0xfe400000-0xfe5fffff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.3:   bridge window [mem 0xc1a0000000-0xc1bfffffff 64bit pref]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.4: PCI bridge to [bus 06]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.4:   bridge window [io  0xf000-0xffff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.4:   bridge window [mem 0xfe200000-0xfe3fffff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.4:   bridge window [mem 0xc180000000-0xc19fffffff 64bit pref]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.5: PCI bridge to [bus 07]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.5:   bridge window [io  0xe000-0xefff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.5:   bridge window [mem 0xfe000000-0xfe1fffff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.5:   bridge window [mem 0xc160000000-0xc17fffffff 64bit pref]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.6: PCI bridge to [bus 08]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.6:   bridge window [io  0xb000-0xbfff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.6:   bridge window [mem 0xfde00000-0xfdffffff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.6:   bridge window [mem 0xc140000000-0xc15fffffff 64bit pref]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.7: PCI bridge to [bus 09]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.7:   bridge window [io  0xa000-0xafff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.7:   bridge window [mem 0xfdc00000-0xfddfffff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:02.7:   bridge window [mem 0xc120000000-0xc13fffffff 64bit pref]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.0: PCI bridge to [bus 0a]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.0:   bridge window [io  0x9000-0x9fff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.0:   bridge window [mem 0xfda00000-0xfdbfffff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.0:   bridge window [mem 0xc100000000-0xc11fffffff 64bit pref]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.1: PCI bridge to [bus 0b]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.1:   bridge window [io  0x8000-0x8fff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.1:   bridge window [mem 0xfd800000-0xfd9fffff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.1:   bridge window [mem 0xc0e0000000-0xc0ffffffff 64bit pref]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.2: PCI bridge to [bus 0c]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.2:   bridge window [io  0x7000-0x7fff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.2:   bridge window [mem 0xfd600000-0xfd7fffff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.2:   bridge window [mem 0xc0c0000000-0xc0dfffffff 64bit pref]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.3: PCI bridge to [bus 0d]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.3:   bridge window [io  0x6000-0x6fff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.3:   bridge window [mem 0xfd400000-0xfd5fffff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.3:   bridge window [mem 0xc0a0000000-0xc0bfffffff 64bit pref]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.4: PCI bridge to [bus 0e]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.4:   bridge window [io  0x5000-0x5fff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.4:   bridge window [mem 0xfd200000-0xfd3fffff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.4:   bridge window [mem 0xc080000000-0xc09fffffff 64bit pref]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.5: PCI bridge to [bus 0f]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.5:   bridge window [io  0x4000-0x4fff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.5:   bridge window [mem 0xfd000000-0xfd1fffff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.5:   bridge window [mem 0xc060000000-0xc07fffffff 64bit pref]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.6: PCI bridge to [bus 10]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.6:   bridge window [io  0x3000-0x3fff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.6:   bridge window [mem 0xfce00000-0xfcffffff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.6:   bridge window [mem 0xc040000000-0xc05fffffff 64bit pref]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.7: PCI bridge to [bus 11]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.7:   bridge window [io  0x2000-0x2fff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.7:   bridge window [mem 0xfcc00000-0xfcdfffff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:03.7:   bridge window [mem 0xc020000000-0xc03fffffff 64bit pref]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:04.0: PCI bridge to [bus 12]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:04.0:   bridge window [io  0x1000-0x1fff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:04.0:   bridge window [mem 0xfca00000-0xfcbfffff]
Jul 20 15:59:03 np0000005515 kernel: pci 0000:00:04.0:   bridge window [mem 0xc000000000-0xc01fffffff 64bit pref]
Jul 20 15:59:03 np0000005515 kernel: pci_bus 0000:00: resource 4 [io  0x0000-0x0cf7 window]
Jul 20 15:59:03 np0000005515 kernel: pci_bus 0000:00: resource 5 [io  0x0d00-0xffff window]
Jul 20 15:59:03 np0000005515 kernel: pci_bus 0000:00: resource 6 [mem 0x000a0000-0x000bffff window]
Jul 20 15:59:03 np0000005515 kernel: pci_bus 0000:00: resource 7 [mem 0x80000000-0xafffffff window]
Jul 20 15:59:03 np0000005515 kernel: pci_bus 0000:00: resource 8 [mem 0xc0000000-0xfebfffff window]
Jul 20 15:59:03 np0000005515 kernel: pci_bus 0000:00: resource 9 [mem 0xc000000000-0xc7ffffffff window]
Jul 20 15:59:03 np0000005515 kernel: pci_bus 0000:01: resource 0 [io  0xc000-0xcfff]
Jul 20 15:59:03 np0000005515 kernel: pci_bus 0000:01: resource 1 [mem 0xfc600000-0xfc9fffff]
Jul 20 15:59:03 np0000005515 kernel: pci_bus 0000:01: resource 2 [mem 0xc200000000-0xc21fffffff 64bit pref]
Jul 20 15:59:03 np0000005515 kernel: pci_bus 0000:02: resource 0 [io  0xc000-0xcfff]
Jul 20 15:59:03 np0000005515 kernel: pci_bus 0000:02: resource 1 [mem 0xfc600000-0xfc7fffff]
Jul 20 15:59:03 np0000005515 kernel: pci_bus 0000:02: resource 2 [mem 0xc200000000-0xc21fffffff 64bit pref]
Jul 20 15:59:03 np0000005515 kernel: pci_bus 0000:03: resource 1 [mem 0xfe800000-0xfe9fffff]
Jul 20 15:59:03 np0000005515 kernel: pci_bus 0000:03: resource 2 [mem 0xc1e0000000-0xc1ffffffff 64bit pref]
Jul 20 15:59:03 np0000005515 kernel: pci_bus 0000:04: resource 1 [mem 0xfe600000-0xfe7fffff]
Jul 20 15:59:03 np0000005515 kernel: pci_bus 0000:04: resource 2 [mem 0xc1c0000000-0xc1dfffffff 64bit pref]
Jul 20 15:59:03 np0000005515 kernel: pci_bus 0000:05: resource 1 [mem 0xfe400000-0xfe5fffff]
Jul 20 15:59:03 np0000005515 kernel: pci_bus 0000:05: resource 2 [mem 0xc1a0000000-0xc1bfffffff 64bit pref]
Jul 20 15:59:03 np0000005515 kernel: pci_bus 0000:06: resource 0 [io  0xf000-0xffff]
Jul 20 15:59:03 np0000005515 kernel: pci_bus 0000:06: resource 1 [mem 0xfe200000-0xfe3fffff]
Jul 20 15:59:03 np0000005515 kernel: pci_bus 0000:06: resource 2 [mem 0xc180000000-0xc19fffffff 64bit pref]
Jul 20 15:59:03 np0000005515 kernel: pci_bus 0000:07: resource 0 [io  0xe000-0xefff]
Jul 20 15:59:03 np0000005515 kernel: pci_bus 0000:07: resource 1 [mem 0xfe000000-0xfe1fffff]
Jul 20 15:59:03 np0000005515 kernel: pci_bus 0000:07: resource 2 [mem 0xc160000000-0xc17fffffff 64bit pref]
Jul 20 15:59:03 np0000005515 kernel: pci_bus 0000:08: resource 0 [io  0xb000-0xbfff]
Jul 20 15:59:03 np0000005515 kernel: pci_bus 0000:08: resource 1 [mem 0xfde00000-0xfdffffff]
Jul 20 15:59:03 np0000005515 kernel: pci_bus 0000:08: resource 2 [mem 0xc140000000-0xc15fffffff 64bit pref]
Jul 20 15:59:03 np0000005515 kernel: pci_bus 0000:09: resource 0 [io  0xa000-0xafff]
Jul 20 15:59:03 np0000005515 kernel: pci_bus 0000:09: resource 1 [mem 0xfdc00000-0xfddfffff]
Jul 20 15:59:03 np0000005515 kernel: pci_bus 0000:09: resource 2 [mem 0xc120000000-0xc13fffffff 64bit pref]
Jul 20 15:59:03 np0000005515 kernel: pci_bus 0000:0a: resource 0 [io  0x9000-0x9fff]
Jul 20 15:59:03 np0000005515 kernel: pci_bus 0000:0a: resource 1 [mem 0xfda00000-0xfdbfffff]
Jul 20 15:59:03 np0000005515 kernel: pci_bus 0000:0a: resource 2 [mem 0xc100000000-0xc11fffffff 64bit pref]
Jul 20 15:59:03 np0000005515 kernel: pci_bus 0000:0b: resource 0 [io  0x8000-0x8fff]
Jul 20 15:59:03 np0000005515 kernel: pci_bus 0000:0b: resource 1 [mem 0xfd800000-0xfd9fffff]
Jul 20 15:59:03 np0000005515 kernel: pci_bus 0000:0b: resource 2 [mem 0xc0e0000000-0xc0ffffffff 64bit pref]
Jul 20 15:59:03 np0000005515 kernel: pci_bus 0000:0c: resource 0 [io  0x7000-0x7fff]
Jul 20 15:59:03 np0000005515 kernel: pci_bus 0000:0c: resource 1 [mem 0xfd600000-0xfd7fffff]
Jul 20 15:59:03 np0000005515 kernel: pci_bus 0000:0c: resource 2 [mem 0xc0c0000000-0xc0dfffffff 64bit pref]
Jul 20 15:59:03 np0000005515 kernel: pci_bus 0000:0d: resource 0 [io  0x6000-0x6fff]
Jul 20 15:59:03 np0000005515 kernel: pci_bus 0000:0d: resource 1 [mem 0xfd400000-0xfd5fffff]
Jul 20 15:59:03 np0000005515 kernel: pci_bus 0000:0d: resource 2 [mem 0xc0a0000000-0xc0bfffffff 64bit pref]
Jul 20 15:59:03 np0000005515 kernel: pci_bus 0000:0e: resource 0 [io  0x5000-0x5fff]
Jul 20 15:59:03 np0000005515 kernel: pci_bus 0000:0e: resource 1 [mem 0xfd200000-0xfd3fffff]
Jul 20 15:59:03 np0000005515 kernel: pci_bus 0000:0e: resource 2 [mem 0xc080000000-0xc09fffffff 64bit pref]
Jul 20 15:59:03 np0000005515 kernel: pci_bus 0000:0f: resource 0 [io  0x4000-0x4fff]
Jul 20 15:59:03 np0000005515 kernel: pci_bus 0000:0f: resource 1 [mem 0xfd000000-0xfd1fffff]
Jul 20 15:59:03 np0000005515 kernel: pci_bus 0000:0f: resource 2 [mem 0xc060000000-0xc07fffffff 64bit pref]
Jul 20 15:59:03 np0000005515 kernel: pci_bus 0000:10: resource 0 [io  0x3000-0x3fff]
Jul 20 15:59:03 np0000005515 kernel: pci_bus 0000:10: resource 1 [mem 0xfce00000-0xfcffffff]
Jul 20 15:59:03 np0000005515 kernel: pci_bus 0000:10: resource 2 [mem 0xc040000000-0xc05fffffff 64bit pref]
Jul 20 15:59:03 np0000005515 kernel: pci_bus 0000:11: resource 0 [io  0x2000-0x2fff]
Jul 20 15:59:03 np0000005515 kernel: pci_bus 0000:11: resource 1 [mem 0xfcc00000-0xfcdfffff]
Jul 20 15:59:03 np0000005515 kernel: pci_bus 0000:11: resource 2 [mem 0xc020000000-0xc03fffffff 64bit pref]
Jul 20 15:59:03 np0000005515 kernel: pci_bus 0000:12: resource 0 [io  0x1000-0x1fff]
Jul 20 15:59:03 np0000005515 kernel: pci_bus 0000:12: resource 1 [mem 0xfca00000-0xfcbfffff]
Jul 20 15:59:03 np0000005515 kernel: pci_bus 0000:12: resource 2 [mem 0xc000000000-0xc01fffffff 64bit pref]
Jul 20 15:59:03 np0000005515 kernel: ACPI: \_SB_.GSIG: Enabled at IRQ 22
Jul 20 15:59:03 np0000005515 kernel: PCI: CLS 0 bytes, default 64
Jul 20 15:59:03 np0000005515 kernel: Trying to unpack rootfs image as initramfs...
Jul 20 15:59:03 np0000005515 kernel: PCI-DMA: Using software bounce buffering for IO (SWIOTLB)
Jul 20 15:59:03 np0000005515 kernel: software IO TLB: mapped [mem 0x000000003b000000-0x000000003f000000] (64MB)
Jul 20 15:59:03 np0000005515 kernel: Initialise system trusted keyrings
Jul 20 15:59:03 np0000005515 kernel: Key type blacklist registered
Jul 20 15:59:03 np0000005515 kernel: workingset: timestamp_bits=36 max_order=23 bucket_order=0
Jul 20 15:59:03 np0000005515 kernel: zbud: loaded
Jul 20 15:59:03 np0000005515 kernel: squashfs: version 4.0 (2009/01/31) Phillip Lougher
Jul 20 15:59:03 np0000005515 kernel: fuse: init (API version 7.39)
Jul 20 15:59:03 np0000005515 kernel: integrity: Platform Keyring initialized
Jul 20 15:59:03 np0000005515 kernel: integrity: Machine keyring initialized
Jul 20 15:59:03 np0000005515 kernel: Key type asymmetric registered
Jul 20 15:59:03 np0000005515 kernel: Asymmetric key parser 'x509' registered
Jul 20 15:59:03 np0000005515 kernel: Block layer SCSI generic (bsg) driver version 0.4 loaded (major 243)
Jul 20 15:59:03 np0000005515 kernel: io scheduler mq-deadline registered
Jul 20 15:59:03 np0000005515 kernel: pcieport 0000:00:02.0: PME: Signaling with IRQ 24
Jul 20 15:59:03 np0000005515 kernel: pcieport 0000:00:02.0: AER: enabled with IRQ 24
Jul 20 15:59:03 np0000005515 kernel: pcieport 0000:00:02.1: PME: Signaling with IRQ 25
Jul 20 15:59:03 np0000005515 kernel: pcieport 0000:00:02.1: AER: enabled with IRQ 25
Jul 20 15:59:03 np0000005515 kernel: pcieport 0000:00:02.2: PME: Signaling with IRQ 26
Jul 20 15:59:03 np0000005515 kernel: pcieport 0000:00:02.2: AER: enabled with IRQ 26
Jul 20 15:59:03 np0000005515 kernel: pcieport 0000:00:02.3: PME: Signaling with IRQ 27
Jul 20 15:59:03 np0000005515 kernel: pcieport 0000:00:02.3: AER: enabled with IRQ 27
Jul 20 15:59:03 np0000005515 kernel: pcieport 0000:00:02.4: PME: Signaling with IRQ 28
Jul 20 15:59:03 np0000005515 kernel: pcieport 0000:00:02.4: AER: enabled with IRQ 28
Jul 20 15:59:03 np0000005515 kernel: pcieport 0000:00:02.5: PME: Signaling with IRQ 29
Jul 20 15:59:03 np0000005515 kernel: pcieport 0000:00:02.5: AER: enabled with IRQ 29
Jul 20 15:59:03 np0000005515 kernel: pcieport 0000:00:02.6: PME: Signaling with IRQ 30
Jul 20 15:59:03 np0000005515 kernel: pcieport 0000:00:02.6: AER: enabled with IRQ 30
Jul 20 15:59:03 np0000005515 kernel: pcieport 0000:00:02.7: PME: Signaling with IRQ 31
Jul 20 15:59:03 np0000005515 kernel: pcieport 0000:00:02.7: AER: enabled with IRQ 31
Jul 20 15:59:03 np0000005515 kernel: ACPI: \_SB_.GSIH: Enabled at IRQ 23
Jul 20 15:59:03 np0000005515 kernel: pcieport 0000:00:03.0: PME: Signaling with IRQ 32
Jul 20 15:59:03 np0000005515 kernel: pcieport 0000:00:03.0: AER: enabled with IRQ 32
Jul 20 15:59:03 np0000005515 kernel: pcieport 0000:00:03.1: PME: Signaling with IRQ 33
Jul 20 15:59:03 np0000005515 kernel: pcieport 0000:00:03.1: AER: enabled with IRQ 33
Jul 20 15:59:03 np0000005515 kernel: pcieport 0000:00:03.2: PME: Signaling with IRQ 34
Jul 20 15:59:03 np0000005515 kernel: pcieport 0000:00:03.2: AER: enabled with IRQ 34
Jul 20 15:59:03 np0000005515 kernel: pcieport 0000:00:03.3: PME: Signaling with IRQ 35
Jul 20 15:59:03 np0000005515 kernel: pcieport 0000:00:03.3: AER: enabled with IRQ 35
Jul 20 15:59:03 np0000005515 kernel: pcieport 0000:00:03.4: PME: Signaling with IRQ 36
Jul 20 15:59:03 np0000005515 kernel: pcieport 0000:00:03.4: AER: enabled with IRQ 36
Jul 20 15:59:03 np0000005515 kernel: pcieport 0000:00:03.5: PME: Signaling with IRQ 37
Jul 20 15:59:03 np0000005515 kernel: pcieport 0000:00:03.5: AER: enabled with IRQ 37
Jul 20 15:59:03 np0000005515 kernel: Freeing initrd memory: 30332K
Jul 20 15:59:03 np0000005515 kernel: pcieport 0000:00:03.6: PME: Signaling with IRQ 38
Jul 20 15:59:03 np0000005515 kernel: pcieport 0000:00:03.6: AER: enabled with IRQ 38
Jul 20 15:59:03 np0000005515 kernel: pcieport 0000:00:03.7: PME: Signaling with IRQ 39
Jul 20 15:59:03 np0000005515 kernel: pcieport 0000:00:03.7: AER: enabled with IRQ 39
Jul 20 15:59:03 np0000005515 kernel: ACPI: \_SB_.GSIE: Enabled at IRQ 20
Jul 20 15:59:03 np0000005515 kernel: pcieport 0000:00:04.0: PME: Signaling with IRQ 40
Jul 20 15:59:03 np0000005515 kernel: pcieport 0000:00:04.0: AER: enabled with IRQ 40
Jul 20 15:59:03 np0000005515 kernel: shpchp 0000:01:00.0: HPC vendor_id 1b36 device_id e ss_vid 0 ss_did 0
Jul 20 15:59:03 np0000005515 kernel: shpchp 0000:01:00.0: pci_hp_register failed with error -16
Jul 20 15:59:03 np0000005515 kernel: shpchp 0000:01:00.0: Slot initialization failed
Jul 20 15:59:03 np0000005515 kernel: shpchp: Standard Hot Plug PCI Controller Driver version: 0.4
Jul 20 15:59:03 np0000005515 kernel: Driver imsttfb not loading because of nomodeset parameter
Jul 20 15:59:03 np0000005515 kernel: Driver asiliantfb not loading because of nomodeset parameter
Jul 20 15:59:03 np0000005515 kernel: input: Power Button as /devices/LNXSYSTM:00/LNXPWRBN:00/input/input0
Jul 20 15:59:03 np0000005515 kernel: ACPI: button: Power Button [PWRF]
Jul 20 15:59:03 np0000005515 kernel: ACPI: \_SB_.GSIF: Enabled at IRQ 21
Jul 20 15:59:03 np0000005515 kernel: Free page reporting enabled
Jul 20 15:59:03 np0000005515 kernel: Serial: 8250/16550 driver, 32 ports, IRQ sharing enabled
Jul 20 15:59:03 np0000005515 kernel: 00:00: ttyS0 at I/O 0x3f8 (irq = 4, base_baud = 115200) is a 16550A
Jul 20 15:59:03 np0000005515 kernel: Linux agpgart interface v0.103
Jul 20 15:59:03 np0000005515 kernel: loop: module loaded
Jul 20 15:59:03 np0000005515 kernel: virtio_scsi virtio2: 12/0/0 default/read/poll queues
Jul 20 15:59:03 np0000005515 kernel: scsi host0: Virtio SCSI HBA
Jul 20 15:59:03 np0000005515 kernel: scsi 0:0:0:0: Direct-Access     QEMU     QEMU HARDDISK    2.5+ PQ: 0 ANSI: 5
Jul 20 15:59:03 np0000005515 kernel: ACPI: bus type drm_connector registered
Jul 20 15:59:03 np0000005515 kernel: tun: Universal TUN/TAP device driver, 1.6
Jul 20 15:59:03 np0000005515 kernel: scsi 0:0:0:1: Direct-Access     QEMU     QEMU HARDDISK    2.5+ PQ: 0 ANSI: 5
Jul 20 15:59:03 np0000005515 kernel: PPP generic driver version 2.4.2
Jul 20 15:59:03 np0000005515 kernel: uhci_hcd 0000:02:01.0: UHCI Host Controller
Jul 20 15:59:03 np0000005515 kernel: uhci_hcd 0000:02:01.0: new USB bus registered, assigned bus number 1
Jul 20 15:59:03 np0000005515 kernel: uhci_hcd 0000:02:01.0: detected 2 ports
Jul 20 15:59:03 np0000005515 kernel: uhci_hcd 0000:02:01.0: irq 22, io port 0x0000c000
Jul 20 15:59:03 np0000005515 kernel: usb usb1: New USB device found, idVendor=1d6b, idProduct=0001, bcdDevice= 6.08
Jul 20 15:59:03 np0000005515 kernel: usb usb1: New USB device strings: Mfr=3, Product=2, SerialNumber=1
Jul 20 15:59:03 np0000005515 kernel: usb usb1: Product: UHCI Host Controller
Jul 20 15:59:03 np0000005515 kernel: usb usb1: Manufacturer: Linux 6.8.0-136-generic uhci_hcd
Jul 20 15:59:03 np0000005515 kernel: usb usb1: SerialNumber: 0000:02:01.0
Jul 20 15:59:03 np0000005515 kernel: hub 1-0:1.0: USB hub found
Jul 20 15:59:03 np0000005515 kernel: hub 1-0:1.0: 2 ports detected
Jul 20 15:59:03 np0000005515 kernel: i8042: PNP: PS/2 Controller [PNP0303:KBD,PNP0f13:MOU] at 0x60,0x64 irq 1,12
Jul 20 15:59:03 np0000005515 kernel: serio: i8042 KBD port at 0x60,0x64 irq 1
Jul 20 15:59:03 np0000005515 kernel: serio: i8042 AUX port at 0x60,0x64 irq 12
Jul 20 15:59:03 np0000005515 kernel: mousedev: PS/2 mouse device common for all mice
Jul 20 15:59:03 np0000005515 kernel: rtc_cmos 00:03: RTC can wake from S4
Jul 20 15:59:03 np0000005515 kernel: rtc_cmos 00:03: registered as rtc0
Jul 20 15:59:03 np0000005515 kernel: rtc_cmos 00:03: setting system clock to 2026-07-20T15:59:01 UTC (1784563141)
Jul 20 15:59:03 np0000005515 kernel: rtc_cmos 00:03: alarms up to one day, y3k, 242 bytes nvram
Jul 20 15:59:03 np0000005515 kernel: i2c_dev: i2c /dev entries driver
Jul 20 15:59:03 np0000005515 kernel: device-mapper: core: CONFIG_IMA_DISABLE_HTABLE is disabled. Duplicate IMA measurements will not be recorded in the IMA log.
Jul 20 15:59:03 np0000005515 kernel: device-mapper: uevent: version 1.0.3
Jul 20 15:59:03 np0000005515 kernel: scsi 0:0:0:0: Attached scsi generic sg0 type 0
Jul 20 15:59:03 np0000005515 kernel: input: AT Translated Set 2 keyboard as /devices/platform/i8042/serio0/input/input1
Jul 20 15:59:03 np0000005515 kernel: sd 0:0:0:0: Power-on or device reset occurred
Jul 20 15:59:03 np0000005515 kernel: device-mapper: ioctl: 4.48.0-ioctl (2023-03-01) initialised: dm-devel@redhat.com
Jul 20 15:59:03 np0000005515 kernel: sd 0:0:0:0: [sda] 209715200 512-byte logical blocks: (107 GB/100 GiB)
Jul 20 15:59:03 np0000005515 kernel: amd_pstate: the _CPC object is not present in SBIOS or ACPI disabled
Jul 20 15:59:03 np0000005515 kernel: sd 0:0:0:1: Attached scsi generic sg1 type 0
Jul 20 15:59:03 np0000005515 kernel: sd 0:0:0:1: Power-on or device reset occurred
Jul 20 15:59:03 np0000005515 kernel: sd 0:0:0:1: [sdb] 482344960 512-byte logical blocks: (247 GB/230 GiB)
Jul 20 15:59:03 np0000005515 kernel: sd 0:0:0:1: [sdb] Write Protect is off
Jul 20 15:59:03 np0000005515 kernel: sd 0:0:0:1: [sdb] Mode Sense: 63 00 00 08
Jul 20 15:59:03 np0000005515 kernel: sd 0:0:0:1: [sdb] Write cache: enabled, read cache: enabled, doesn't support DPO or FUA
Jul 20 15:59:03 np0000005515 kernel: sd 0:0:0:0: [sda] Write Protect is off
Jul 20 15:59:03 np0000005515 kernel: ledtrig-cpu: registered to indicate activity on CPUs
Jul 20 15:59:03 np0000005515 kernel: drop_monitor: Initializing network drop monitor service
Jul 20 15:59:03 np0000005515 kernel: NET: Registered PF_INET6 protocol family
Jul 20 15:59:03 np0000005515 kernel: sd 0:0:0:1: [sdb] Attached SCSI disk
Jul 20 15:59:03 np0000005515 kernel: Segment Routing with IPv6
Jul 20 15:59:03 np0000005515 kernel: sd 0:0:0:0: [sda] Mode Sense: 63 00 00 08
Jul 20 15:59:03 np0000005515 kernel: In-situ OAM (IOAM) with IPv6
Jul 20 15:59:03 np0000005515 kernel: sd 0:0:0:0: [sda] Write cache: enabled, read cache: enabled, doesn't support DPO or FUA
Jul 20 15:59:03 np0000005515 kernel: NET: Registered PF_PACKET protocol family
Jul 20 15:59:03 np0000005515 kernel:  sda: sda1 sda14 sda15 sda16
Jul 20 15:59:03 np0000005515 kernel: Key type dns_resolver registered
Jul 20 15:59:03 np0000005515 kernel: sd 0:0:0:0: [sda] Attached SCSI disk
Jul 20 15:59:03 np0000005515 kernel: IPI shorthand broadcast: enabled
Jul 20 15:59:03 np0000005515 kernel: sched_clock: Marking stable (1061004365, 79403815)->(1205820496, -65412316)
Jul 20 15:59:03 np0000005515 kernel: registered taskstats version 1
Jul 20 15:59:03 np0000005515 kernel: Loading compiled-in X.509 certificates
Jul 20 15:59:03 np0000005515 kernel: Loaded X.509 cert 'Build time autogenerated kernel key: eea4a9707394bf26b4f59ee0ef16383ba94b4361'
Jul 20 15:59:03 np0000005515 kernel: Loaded X.509 cert 'Canonical Ltd. Live Patch Signing 2025 Kmod: d541cef61dc7e793b7eb7e899970a2eef0b5dc8c'
Jul 20 15:59:03 np0000005515 kernel: Loaded X.509 cert 'Canonical Ltd. Live Patch Signing: 14df34d1a87cf37625abec039ef2bf521249b969'
Jul 20 15:59:03 np0000005515 kernel: Loaded X.509 cert 'Canonical Ltd. Kernel Module Signing 2025 Kmod: 4627603d2357a2a3f81006370894c221175893e9'
Jul 20 15:59:03 np0000005515 kernel: Loaded X.509 cert 'Canonical Ltd. Kernel Module Signing: 88f752e560a1e0737e31163a466ad7b70a850c19'
Jul 20 15:59:03 np0000005515 kernel: blacklist: Loading compiled-in revocation X.509 certificates
Jul 20 15:59:03 np0000005515 kernel: Loaded X.509 cert 'Canonical Ltd. Secure Boot Signing: 61482aa2830d0ab2ad5af10b7250da9033ddcef0'
Jul 20 15:59:03 np0000005515 kernel: Loaded X.509 cert 'Canonical Ltd. Secure Boot Signing (2017): 242ade75ac4a15e50d50c84b0d45ff3eae707a03'
Jul 20 15:59:03 np0000005515 kernel: Loaded X.509 cert 'Canonical Ltd. Secure Boot Signing (ESM 2018): 365188c1d374d6b07c3c8f240f8ef722433d6a8b'
Jul 20 15:59:03 np0000005515 kernel: Loaded X.509 cert 'Canonical Ltd. Secure Boot Signing (2019): c0746fd6c5da3ae827864651ad66ae47fe24b3e8'
Jul 20 15:59:03 np0000005515 kernel: Loaded X.509 cert 'Canonical Ltd. Secure Boot Signing (2021 v1): a8d54bbb3825cfb94fa13c9f8a594a195c107b8d'
Jul 20 15:59:03 np0000005515 kernel: Loaded X.509 cert 'Canonical Ltd. Secure Boot Signing (2021 v2): 4cf046892d6fd3c9a5b03f98d845f90851dc6a8c'
Jul 20 15:59:03 np0000005515 kernel: Loaded X.509 cert 'Canonical Ltd. Secure Boot Signing (2021 v3): 100437bb6de6e469b581e61cd66bce3ef4ed53af'
Jul 20 15:59:03 np0000005515 kernel: Loaded X.509 cert 'Canonical Ltd. Secure Boot Signing (Ubuntu Core 2019): c1d57b8f6b743f23ee41f4f7ee292f06eecadfb9'
Jul 20 15:59:03 np0000005515 kernel: Key type .fscrypt registered
Jul 20 15:59:03 np0000005515 kernel: Key type fscrypt-provisioning registered
Jul 20 15:59:03 np0000005515 kernel: cryptd: max_cpu_qlen set to 1000
Jul 20 15:59:03 np0000005515 kernel: AVX2 version of gcm_enc/dec engaged.
Jul 20 15:59:03 np0000005515 kernel: AES CTR mode by8 optimization enabled
Jul 20 15:59:03 np0000005515 kernel: Key type encrypted registered
Jul 20 15:59:03 np0000005515 kernel: AppArmor: AppArmor sha256 policy hashing enabled
Jul 20 15:59:03 np0000005515 kernel: ima: No TPM chip found, activating TPM-bypass!
Jul 20 15:59:03 np0000005515 kernel: Loading compiled-in module X.509 certificates
Jul 20 15:59:03 np0000005515 kernel: Loaded X.509 cert 'Build time autogenerated kernel key: eea4a9707394bf26b4f59ee0ef16383ba94b4361'
Jul 20 15:59:03 np0000005515 kernel: ima: Allocated hash algorithm: sha256
Jul 20 15:59:03 np0000005515 kernel: ima: No architecture policies found
Jul 20 15:59:03 np0000005515 kernel: evm: Initialising EVM extended attributes:
Jul 20 15:59:03 np0000005515 kernel: evm: security.selinux
Jul 20 15:59:03 np0000005515 kernel: evm: security.SMACK64
Jul 20 15:59:03 np0000005515 kernel: evm: security.SMACK64EXEC
Jul 20 15:59:03 np0000005515 kernel: evm: security.SMACK64TRANSMUTE
Jul 20 15:59:03 np0000005515 kernel: evm: security.SMACK64MMAP
Jul 20 15:59:03 np0000005515 kernel: evm: security.apparmor
Jul 20 15:59:03 np0000005515 kernel: evm: security.ima
Jul 20 15:59:03 np0000005515 kernel: evm: security.capability
Jul 20 15:59:03 np0000005515 kernel: evm: HMAC attrs: 0x1
Jul 20 15:59:03 np0000005515 kernel: PM:   Magic number: 2:543:993
Jul 20 15:59:03 np0000005515 kernel: machinecheck machinecheck6: hash matches
Jul 20 15:59:03 np0000005515 kernel: memory memory36: hash matches
Jul 20 15:59:03 np0000005515 kernel: RAS: Correctable Errors collector initialized.
Jul 20 15:59:03 np0000005515 kernel: clk: Disabling unused clocks
Jul 20 15:59:03 np0000005515 kernel: Freeing unused decrypted memory: 2028K
Jul 20 15:59:03 np0000005515 kernel: Freeing unused kernel image (initmem) memory: 4932K
Jul 20 15:59:03 np0000005515 kernel: Write protecting the kernel read-only data: 38912k
Jul 20 15:59:03 np0000005515 kernel: Freeing unused kernel image (rodata/data gap) memory: 1956K
Jul 20 15:59:03 np0000005515 kernel: x86/mm: Checked W+X mappings: passed, no W+X pages found.
Jul 20 15:59:03 np0000005515 kernel: Run /init as init process
Jul 20 15:59:03 np0000005515 kernel:   with arguments:
Jul 20 15:59:03 np0000005515 kernel:     /init
Jul 20 15:59:03 np0000005515 kernel:     nofb
Jul 20 15:59:03 np0000005515 kernel:   with environment:
Jul 20 15:59:03 np0000005515 kernel:     HOME=/
Jul 20 15:59:03 np0000005515 kernel:     TERM=linux
Jul 20 15:59:03 np0000005515 kernel:     vga=normal
Jul 20 15:59:03 np0000005515 kernel: usb 1-1: new full-speed USB device number 2 using uhci_hcd
Jul 20 15:59:03 np0000005515 kernel: virtio_gpu: probe of virtio0 failed with error -22
Jul 20 15:59:03 np0000005515 kernel: ahci 0000:00:1f.2: version 3.0
Jul 20 15:59:03 np0000005515 kernel: ACPI: \_SB_.GSIA: Enabled at IRQ 16
Jul 20 15:59:03 np0000005515 kernel: virtio_net virtio6 enp8s0: renamed from eth2
Jul 20 15:59:03 np0000005515 kernel: ahci 0000:00:1f.2: AHCI 0001.0000 32 slots 6 ports 1.5 Gbps 0x3f impl SATA mode
Jul 20 15:59:03 np0000005515 kernel: ahci 0000:00:1f.2: flags: 64bit ncq only 
Jul 20 15:59:03 np0000005515 kernel: virtio_net virtio1 enp3s0: renamed from eth0
Jul 20 15:59:03 np0000005515 kernel: input: VirtualPS/2 VMware VMMouse as /devices/platform/i8042/serio1/input/input4
Jul 20 15:59:03 np0000005515 kernel: usb 1-1: New USB device found, idVendor=0627, idProduct=0001, bcdDevice= 0.00
Jul 20 15:59:03 np0000005515 kernel: usb 1-1: New USB device strings: Mfr=1, Product=3, SerialNumber=10
Jul 20 15:59:03 np0000005515 kernel: usb 1-1: Product: QEMU USB Tablet
Jul 20 15:59:03 np0000005515 kernel: usb 1-1: Manufacturer: QEMU
Jul 20 15:59:03 np0000005515 kernel: usb 1-1: SerialNumber: 28754-0000:00:02.0:00.0:01.0-1
Jul 20 15:59:03 np0000005515 kernel: virtio_net virtio5 enp7s0: renamed from eth1
Jul 20 15:59:03 np0000005515 kernel: scsi host1: ahci
Jul 20 15:59:03 np0000005515 kernel: input: VirtualPS/2 VMware VMMouse as /devices/platform/i8042/serio1/input/input3
Jul 20 15:59:03 np0000005515 kernel: scsi host2: ahci
Jul 20 15:59:03 np0000005515 kernel: scsi host3: ahci
Jul 20 15:59:03 np0000005515 kernel: scsi host4: ahci
Jul 20 15:59:03 np0000005515 kernel: scsi host5: ahci
Jul 20 15:59:03 np0000005515 kernel: virtio_net virtio7 enp9s0: renamed from eth3
Jul 20 15:59:03 np0000005515 kernel: scsi host6: ahci
Jul 20 15:59:03 np0000005515 kernel: ata1: SATA max UDMA/133 abar m4096@0xfea22000 port 0xfea22100 irq 70 lpm-pol 0
Jul 20 15:59:03 np0000005515 kernel: ata2: SATA max UDMA/133 abar m4096@0xfea22000 port 0xfea22180 irq 70 lpm-pol 0
Jul 20 15:59:03 np0000005515 kernel: ata3: SATA max UDMA/133 abar m4096@0xfea22000 port 0xfea22200 irq 70 lpm-pol 0
Jul 20 15:59:03 np0000005515 kernel: ata4: SATA max UDMA/133 abar m4096@0xfea22000 port 0xfea22280 irq 70 lpm-pol 0
Jul 20 15:59:03 np0000005515 kernel: ata5: SATA max UDMA/133 abar m4096@0xfea22000 port 0xfea22300 irq 70 lpm-pol 0
Jul 20 15:59:03 np0000005515 kernel: ata6: SATA max UDMA/133 abar m4096@0xfea22000 port 0xfea22380 irq 70 lpm-pol 0
Jul 20 15:59:03 np0000005515 kernel: hid: raw HID events driver (C) Jiri Kosina
Jul 20 15:59:03 np0000005515 kernel: ata6: SATA link down (SStatus 0 SControl 300)
Jul 20 15:59:03 np0000005515 kernel: ata3: SATA link down (SStatus 0 SControl 300)
Jul 20 15:59:03 np0000005515 kernel: ata4: SATA link down (SStatus 0 SControl 300)
Jul 20 15:59:03 np0000005515 kernel: ata2: SATA link down (SStatus 0 SControl 300)
Jul 20 15:59:03 np0000005515 kernel: ata1: SATA link down (SStatus 0 SControl 300)
Jul 20 15:59:03 np0000005515 kernel: ata5: SATA link down (SStatus 0 SControl 300)
Jul 20 15:59:03 np0000005515 kernel: usbcore: registered new interface driver usbhid
Jul 20 15:59:03 np0000005515 kernel: usbhid: USB HID core driver
Jul 20 15:59:03 np0000005515 kernel: input: QEMU QEMU USB Tablet as /devices/pci0000:00/0000:00:02.0/0000:01:00.0/0000:02:01.0/usb1/1-1/1-1:1.0/0003:0627:0001.0001/input/input5
Jul 20 15:59:03 np0000005515 kernel: hid-generic 0003:0627:0001.0001: input,hidraw0: USB HID v0.01 Mouse [QEMU QEMU USB Tablet] on usb-0000:02:01.0-1/input0
Jul 20 15:59:03 np0000005515 kernel: raid6: avx2x4   gen() 38310 MB/s
Jul 20 15:59:03 np0000005515 kernel: raid6: avx2x2   gen() 37571 MB/s
Jul 20 15:59:03 np0000005515 kernel: raid6: avx2x1   gen() 28315 MB/s
Jul 20 15:59:03 np0000005515 kernel: raid6: using algorithm avx2x4 gen() 38310 MB/s
Jul 20 15:59:03 np0000005515 kernel: raid6: .... xor() 5364 MB/s, rmw enabled
Jul 20 15:59:03 np0000005515 kernel: raid6: using avx2x2 recovery algorithm
Jul 20 15:59:03 np0000005515 kernel: xor: automatically using best checksumming function   avx       
Jul 20 15:59:03 np0000005515 kernel: async_tx: api initialized (async)
Jul 20 15:59:03 np0000005515 kernel: Btrfs loaded, zoned=yes, fsverity=yes
Jul 20 15:59:03 np0000005515 kernel: EXT4-fs (sda1): mounted filesystem 8515de1c-ba7e-467b-adde-6d9f8a8dbc1f ro with ordered data mode. Quota mode: none.
Jul 20 15:59:03 np0000005515 kernel: Cgroup memory moving (move_charge_at_immigrate) is deprecated. Please report your usecase to linux-mm@kvack.org if you depend on this functionality.
Jul 20 15:59:03 np0000005515 kernel: Key type psk registered
Jul 20 15:59:03 np0000005515 kernel: EXT4-fs (sda1): re-mounted 8515de1c-ba7e-467b-adde-6d9f8a8dbc1f r/w.
Jul 20 15:59:03 np0000005515 kernel: storpool_rdma: loading out-of-tree module taints kernel.
Jul 20 15:59:03 np0000005515 kernel: storpool_rdma: module verification failed: signature and/or required key missing - tainting kernel
Jul 20 15:59:03 np0000005515 kernel: storpool_rdma: timeInit: tscPerUsec: 2395
Jul 20 15:59:03 np0000005515 kernel: virtio_net virtio6 sp0: renamed from enp8s0
Jul 20 15:59:03 np0000005515 kernel: virtio_net virtio5 sp-api: renamed from enp7s0
Jul 20 15:59:03 np0000005515 kernel: virtio_net virtio7 sp1: renamed from enp9s0
Jul 20 15:59:03 np0000005515 kernel: EXT4-fs (sda16): mounted filesystem 7dc15ce9-d090-44d7-bb05-2a36d545a8e3 r/w with ordered data mode. Quota mode: none.
Jul 20 15:59:03 np0000005515 kernel: kvm_amd: TSC scaling supported
Jul 20 15:59:03 np0000005515 kernel: kvm_amd: Nested Virtualization enabled
Jul 20 15:59:03 np0000005515 kernel: kvm_amd: Nested Paging enabled
Jul 20 15:59:03 np0000005515 kernel: kvm_amd: LBR virtualization supported
Jul 20 15:59:03 np0000005515 kernel: kvm_amd: Virtual VMLOAD VMSAVE supported
Jul 20 15:59:03 np0000005515 kernel: kvm_amd: Virtual GIF supported
Jul 20 15:59:03 np0000005515 kernel: audit: type=1400 audit(1784563143.710:2): apparmor="STATUS" operation="profile_load" profile="unconfined" name="brave" pid=1038 comm="apparmor_parser"
Jul 20 15:59:03 np0000005515 kernel: audit: type=1400 audit(1784563143.711:3): apparmor="STATUS" operation="profile_load" profile="unconfined" name="busybox" pid=1040 comm="apparmor_parser"
Jul 20 15:59:03 np0000005515 kernel: audit: type=1400 audit(1784563143.711:4): apparmor="STATUS" operation="profile_load" profile="unconfined" name="Discord" pid=1034 comm="apparmor_parser"
Jul 20 15:59:03 np0000005515 kernel: audit: type=1400 audit(1784563143.711:5): apparmor="STATUS" operation="profile_load" profile="unconfined" name=4D6F6E676F444220436F6D70617373 pid=1035 comm="apparmor_parser"
Jul 20 15:59:03 np0000005515 kernel: audit: type=1400 audit(1784563143.711:6): apparmor="STATUS" operation="profile_load" profile="unconfined" name="balena-etcher" pid=1037 comm="apparmor_parser"
Jul 20 15:59:03 np0000005515 kernel: audit: type=1400 audit(1784563143.711:7): apparmor="STATUS" operation="profile_load" profile="unconfined" name="ch-checkns" pid=1042 comm="apparmor_parser"
Jul 20 15:59:03 np0000005515 kernel: audit: type=1400 audit(1784563143.711:8): apparmor="STATUS" operation="profile_load" profile="unconfined" name="buildah" pid=1039 comm="apparmor_parser"
Jul 20 15:59:03 np0000005515 kernel: audit: type=1400 audit(1784563143.711:9): apparmor="STATUS" operation="profile_load" profile="unconfined" name="1password" pid=1033 comm="apparmor_parser"
Jul 20 15:59:03 np0000005515 kernel: audit: type=1400 audit(1784563143.711:10): apparmor="STATUS" operation="profile_load" profile="unconfined" name="chrome" pid=1044 comm="apparmor_parser"
Jul 20 15:59:08 np0000005515 kernel: kauditd_printk_skb: 112 callbacks suppressed
Jul 20 15:59:08 np0000005515 kernel: audit: type=1400 audit(1784563148.814:123): apparmor="STATUS" operation="profile_replace" info="same as current profile, skipping" profile="unconfined" name="rsyslogd" pid=4928 comm="apparmor_parser"
Jul 20 15:59:08 np0000005515 kernel: loop0: detected capacity change from 0 to 8
Jul 20 15:59:09 np0000005515 kernel: audit: type=1400 audit(1784563149.043:124): apparmor="STATUS" operation="profile_replace" profile="unconfined" name="/usr/lib/snapd/snap-confine" pid=5085 comm="apparmor_parser"
Jul 20 15:59:09 np0000005515 kernel: audit: type=1400 audit(1784563149.050:125): apparmor="STATUS" operation="profile_replace" profile="unconfined" name="/usr/lib/snapd/snap-confine//mount-namespace-capture-helper" pid=5085 comm="apparmor_parser"
Jul 20 15:59:55 np0000005515 sudo[5279]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-kngfktqfeyieipzdslbbtpdosrtiwvcq ; cat /proc/sys/kernel/random/boot_id'
Jul 20 15:59:55 np0000005515 sudo[5279]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:59:55 np0000005515 sudo[5279]: pam_unix(sudo:session): session closed for user root
Jul 20 15:59:55 np0000005515 sudo[5284]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-heyresvmgsbnxgnuqjpcwnnilwxjcggk ; whoami'
Jul 20 15:59:55 np0000005515 sudo[5284]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 15:59:55 np0000005515 sudo[5284]: pam_unix(sudo:session): session closed for user root
Jul 20 16:00:03 np0000005515 sudo[6134]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-usnydhssniqhssvatpaeciwacnqqkwci ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563203.168705-11496-215539033781814/AnsiballZ_ufw.py'
Jul 20 16:00:03 np0000005515 sudo[6134]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 16:00:03 np0000005515 sudo[6134]: pam_unix(sudo:session): session closed for user root
Jul 20 16:00:04 np0000005515 sudo[6179]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-wyalnxysqzfulvpbulfosfuavbdtjozh ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563204.0491092-11496-88247579780987/AnsiballZ_ufw.py'
Jul 20 16:00:04 np0000005515 sudo[6179]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 16:00:04 np0000005515 sudo[6179]: pam_unix(sudo:session): session closed for user root
Jul 20 16:00:04 np0000005515 sudo[6218]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-rzihrrrmpmegddzndrxkmxhplhpwfwjs ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563204.806534-11496-50563521770579/AnsiballZ_ufw.py'
Jul 20 16:00:04 np0000005515 sudo[6218]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 16:00:05 np0000005515 sudo[6218]: pam_unix(sudo:session): session closed for user root
Jul 20 16:00:06 np0000005515 sudo[6334]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-hecnivglitinwnvvykxovcxjbldsuzys ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563206.2627182-11556-5110901748987/AnsiballZ_command.py'
Jul 20 16:00:06 np0000005515 sudo[6334]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 16:00:06 np0000005515 sudo[6334]: pam_unix(sudo:session): session closed for user root
Jul 20 16:00:07 np0000005515 sudo[6357]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-zlqqtqzjbnkkwaekxlkbyhgsbpjhpift ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563207.588664-11587-145500101943110/AnsiballZ_command.py'
Jul 20 16:00:07 np0000005515 sudo[6357]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 16:00:08 np0000005515 sudo[6357]: pam_unix(sudo:session): session closed for user root
Jul 20 16:00:08 np0000005515 sudo[6388]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-ttdzbilhftobzcphdbqifgejmuceopct ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563208.4190729-11604-114699669395335/AnsiballZ_service_facts.py'
Jul 20 16:00:08 np0000005515 sudo[6388]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 16:00:12 np0000005515 sudo[6388]: pam_unix(sudo:session): session closed for user root
Jul 20 16:00:12 np0000005515 sudo[6984]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-zxyyucafdbbwasemwdlgidyfezvxnnxn ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563212.7038357-11622-223491657457940/AnsiballZ_file.py'
Jul 20 16:00:12 np0000005515 sudo[6984]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 16:00:13 np0000005515 sudo[6984]: pam_unix(sudo:session): session closed for user root
Jul 20 16:00:13 np0000005515 sudo[7002]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-zfhdjcoypweiaqxjqpdxydlyyimskmvt ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563213.1015599-11630-90148404293680/AnsiballZ_systemd.py'
Jul 20 16:00:13 np0000005515 sudo[7002]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 16:00:13 np0000005515 sudo[7002]: pam_unix(sudo:session): session closed for user root
Jul 20 16:00:13 np0000005515 sudo[7021]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-ooidwvbwadomwunplitigrpywscyfstj ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563213.6952286-11639-107506402320462/AnsiballZ_command.py'
Jul 20 16:00:13 np0000005515 sudo[7021]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 16:00:14 np0000005515 sudo[7021]: pam_unix(sudo:session): session closed for user root
Jul 20 16:00:14 np0000005515 sudo[7044]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-jlietwimeebckucdnvwjypjootsfcezs ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563214.3038952-11648-174251122645278/AnsiballZ_stat.py'
Jul 20 16:00:14 np0000005515 sudo[7044]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 16:00:14 np0000005515 sudo[7044]: pam_unix(sudo:session): session closed for user root
Jul 20 16:00:14 np0000005515 sudo[7055]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-rflcldshqmkmdjbygqxhnytnsrhjouwt ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563214.3038952-11648-174251122645278/AnsiballZ_copy.py'
Jul 20 16:00:14 np0000005515 sudo[7055]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 16:00:14 np0000005515 sudo[7055]: pam_unix(sudo:session): session closed for user root
Jul 20 16:00:15 np0000005515 sudo[7073]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-clrfpldzlaskcmlujivmbykjkxavejoi ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563215.001829-11663-227747069389902/AnsiballZ_copy.py'
Jul 20 16:00:15 np0000005515 sudo[7073]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 16:00:15 np0000005515 sudo[7073]: pam_unix(sudo:session): session closed for user root
Jul 20 16:00:16 np0000005515 sudo[7114]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-iozxtygevryzfrflihydmekhmtfeucln ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563215.9718063-11686-203059703639699/AnsiballZ_slurp.py'
Jul 20 16:00:16 np0000005515 sudo[7114]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 16:00:16 np0000005515 sudo[7114]: pam_unix(sudo:session): session closed for user root
Jul 20 16:00:16 np0000005515 sudo[7132]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-hbmziyffhhwvncfvefvydyplmcoaqsrt ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563216.528224-11697-90425979404522/AnsiballZ_command.py'
Jul 20 16:00:16 np0000005515 sudo[7132]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 16:00:17 np0000005515 kernel:  sdb: sdb1
Jul 20 16:00:20 np0000005515 sudo[7132]: pam_unix(sudo:session): session closed for user root
Jul 20 16:00:20 np0000005515 sudo[7198]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-tghrjafzhwfyqnqfltjtydkejbyfcujw ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563220.3970304-11705-56495020964969/AnsiballZ_systemd.py'
Jul 20 16:00:20 np0000005515 sudo[7198]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 16:00:20 np0000005515 sudo[7198]: pam_unix(sudo:session): session closed for user root
Jul 20 16:00:21 np0000005515 sudo[7232]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-xmonognjvkaoamoincoimsheghzizbdq ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563221.0089066-11714-75434697117299/AnsiballZ_stat.py'
Jul 20 16:00:21 np0000005515 sudo[7232]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 16:00:21 np0000005515 sudo[7232]: pam_unix(sudo:session): session closed for user root
Jul 20 16:00:21 np0000005515 sudo[7243]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-yjmosylenotcleecnjmznqebseplhxyf ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563221.0089066-11714-75434697117299/AnsiballZ_copy.py'
Jul 20 16:00:21 np0000005515 sudo[7243]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 16:00:21 np0000005515 sudo[7243]: pam_unix(sudo:session): session closed for user root
Jul 20 16:00:21 np0000005515 sudo[7261]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-zrngiexkjvaibepdaqvlajzpjcyujqgq ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563221.7820644-11731-194119832761294/AnsiballZ_stat.py'
Jul 20 16:00:21 np0000005515 sudo[7261]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 16:00:22 np0000005515 sudo[7261]: pam_unix(sudo:session): session closed for user root
Jul 20 16:00:22 np0000005515 sudo[7296]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-xvccstjcgaikbijtizunqhhbrhiayeec ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563222.8117402-11767-166500016956281/AnsiballZ_command.py'
Jul 20 16:00:22 np0000005515 sudo[7296]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 16:00:23 np0000005515 sudo[7296]: pam_unix(sudo:session): session closed for user root
Jul 20 16:00:23 np0000005515 sudo[7319]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-tiohlbtkxwitovrmlmiarjyfwfnfcwbl ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563223.6099205-11789-93171135896605/AnsiballZ_command.py'
Jul 20 16:00:23 np0000005515 sudo[7319]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 16:00:27 np0000005515 sudo[7319]: pam_unix(sudo:session): session closed for user root
Jul 20 16:00:27 np0000005515 sudo[7341]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-chieoypvypzibjkybbdsllageqtkcqmo ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563227.3538547-11807-187733529235784/AnsiballZ_systemd.py'
Jul 20 16:00:27 np0000005515 sudo[7341]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 16:00:27 np0000005515 sudo[7341]: pam_unix(sudo:session): session closed for user root
Jul 20 16:00:28 np0000005515 sudo[7361]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-qpsvkuxgfnretofwnehhqezaldpkvofm ; CGCONFIG_FORCE_STARTUP=1 /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563228.0462515-11825-46065690803252/AnsiballZ_command.py'
Jul 20 16:00:28 np0000005515 sudo[7361]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 16:00:28 np0000005515 sudo[7361]: pam_unix(sudo:session): session closed for user root
Jul 20 16:00:31 np0000005515 sudo[7571]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-bjghffozkasrtbnkxlpoiyozwzfmrilb ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563230.9234693-11875-70631389552885/AnsiballZ_command.py'
Jul 20 16:00:31 np0000005515 sudo[7571]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 16:00:31 np0000005515 sudo[7571]: pam_unix(sudo:session): session closed for user root
Jul 20 16:00:31 np0000005515 sudo[7593]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-kjbpaersbhyzztpsmnmnsusfphcwibkr ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563231.5787072-11891-60280289485494/AnsiballZ_command.py'
Jul 20 16:00:31 np0000005515 sudo[7593]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 16:00:32 np0000005515 sudo[7593]: pam_unix(sudo:session): session closed for user root
Jul 20 16:00:33 np0000005515 sudo[7738]:   ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-lcmitfhtdywvmyvfgcalnlfzvwavntke ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784563232.95018-11907-46596577289899/AnsiballZ_command.py'
Jul 20 16:00:33 np0000005515 sudo[7738]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 16:00:35 np0000005515 kernel: storpool_bd: timeInit: tscPerUsec: 2395
Jul 20 16:00:35 np0000005515 sudo[7738]: pam_unix(sudo:session): session closed for user root
Jul 20 16:00:36 np0000005515 kernel: block sdb: the capability attribute has been deprecated.
Jul 20 16:00:36 np0000005515 kernel: storpool_disk: closeDisk: service 7962: disk sda closed
Jul 20 16:00:37 np0000005515 sudo[8383]:   ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-sbkgevysmzhuofkxjfzjnbbdkpchwaja ; /usr/bin/python3'
Jul 20 16:00:37 np0000005515 sudo[8383]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 16:00:38 np0000005515 sudo[8383]: pam_unix(sudo:session): session closed for user root
Jul 20 16:00:39 np0000005515 sudo[8464]:   ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-sfmgkivgahqzxtvuyobqzdqcfvxzqltw ; /usr/bin/python3'
Jul 20 16:00:39 np0000005515 sudo[8464]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 16:00:39 np0000005515 sudo[8464]: pam_unix(sudo:session): session closed for user root
Jul 20 16:00:39 np0000005515 kernel: virtio_net virtio5 sp-api: entered promiscuous mode
Jul 20 16:00:39 np0000005515 kernel: virtio_net virtio5 sp-api: left promiscuous mode
Jul 20 16:00:39 np0000005515 kernel: virtio_net virtio5 sp-api: entered promiscuous mode
Jul 20 16:00:39 np0000005515 kernel: virtio_net virtio5 sp-api: left promiscuous mode
Jul 20 16:00:39 np0000005515 kernel: virtio_net virtio5 sp-api: entered promiscuous mode
Jul 20 16:00:39 np0000005515 kernel: virtio_net virtio5 sp-api: left promiscuous mode
Jul 20 16:00:39 np0000005515 kernel: virtio_net virtio5 sp-api: entered promiscuous mode
Jul 20 16:00:39 np0000005515 kernel: virtio_net virtio5 sp-api: left promiscuous mode
Jul 20 16:00:39 np0000005515 kernel: virtio_net virtio5 sp-api: entered promiscuous mode
Jul 20 16:00:39 np0000005515 kernel: virtio_net virtio5 sp-api: left promiscuous mode
Jul 20 16:00:39 np0000005515 kernel: virtio_net virtio5 sp-api: entered promiscuous mode
Jul 20 16:00:39 np0000005515 kernel: virtio_net virtio5 sp-api: left promiscuous mode
Jul 20 16:00:40 np0000005515 sudo[8485]:   ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-fehqitcjwhcqawemxbroistctgnknxlb ; /usr/bin/python3'
Jul 20 16:00:40 np0000005515 sudo[8485]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 16:00:40 np0000005515 sudo[8485]: pam_unix(sudo:session): session closed for user root
Jul 20 16:00:41 np0000005515 sudo[8516]:   ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-ylnzeeucwdrroxcvpzpiipwmymxogufq ; /usr/bin/python3'
Jul 20 16:00:41 np0000005515 sudo[8516]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 16:00:41 np0000005515 sudo[8516]: pam_unix(sudo:session): session closed for user root
Jul 20 16:00:41 np0000005515 sudo[8531]:   ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-bipoiidvdhjotrwcsqqgoqdgypcmlofm ; /usr/bin/python3'
Jul 20 16:00:41 np0000005515 sudo[8531]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 16:00:41 np0000005515 sudo[8531]: pam_unix(sudo:session): session closed for user root
Jul 20 16:00:41 np0000005515 sudo[8544]:   ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-kapnqehafnppbiswsypiosizfuuevbpl ; /usr/bin/python3'
Jul 20 16:00:41 np0000005515 sudo[8544]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 16:00:42 np0000005515 sudo[8544]: pam_unix(sudo:session): session closed for user root
Jul 20 16:32:43 np0000005515 kernel: storpool_rdma: netdevNotifier: our interface sp0 is going down!
Jul 20 16:32:43 np0000005515 kernel: storpool_rdma: netdevNotifier: our interface sp0 is going down!
Jul 20 16:32:45 np0000005515 kernel: storpool_rdma: netdevNotifier: our interface sp1 is going down!
Jul 20 16:32:45 np0000005515 kernel: storpool_rdma: netdevNotifier: our interface sp1 is going down!
Jul 20 16:32:49 np0000005515 kernel: storpool_disk: closeDisk: service 7962: disk sdb closed
Jul 20 16:32:49 np0000005515 kernel: storpool_disk: closeDisk: service 16775: disk sda closed
Jul 20 16:33:16 np0000005515 kernel: sd 0:0:0:1: [sdb] Synchronizing SCSI cache
Jul 20 16:33:16 np0000005515 kernel: sd 0:0:0:1: LUN assignments on this target have changed. The Linux SCSI layer does not automatically remap LUN assignments.
Jul 20 16:33:16 np0000005515 kernel: sd 0:0:0:1: [sdb] Synchronize Cache(10) failed: Result: hostbyte=DID_OK driverbyte=DRIVER_OK
Jul 20 16:33:16 np0000005515 kernel: sd 0:0:0:1: [sdb] Sense Key : Illegal Request [current] 
Jul 20 16:33:16 np0000005515 kernel: sd 0:0:0:1: [sdb] Add. Sense: Logical unit not supported
Jul 20 16:33:30 np0000005515 sudo[17020]:   ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-jginpwkkowhlwrzpcxdfuxmhjyewhqar ; /usr/bin/python3'
Jul 20 16:33:30 np0000005515 sudo[17020]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 16:33:30 np0000005515 sudo[17020]: pam_unix(sudo:session): session closed for user root
Jul 20 16:33:30 np0000005515 sudo[17026]:   ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-goiwghwfadlvisdlupixdhevbgwefqwl ; /usr/bin/python3'
Jul 20 16:33:30 np0000005515 sudo[17026]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)
Jul 20 16:33:32 np0000005515 sudo[17026]: pam_unix(sudo:session): session closed for user root
Jul 20 16:33:44 np0000005515 sudo[17083]:   ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-flkzossxcraxxbydupqocekgrpulgbmj ; /usr/bin/python3'
Jul 20 16:33:44 np0000005515 sudo[17083]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)