May 28 00:31:37 np0000001578 sudo[2436]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-vvccyoumajzptnomoyhzvojgwksnjtuo ; /usr/bin/python3' May 28 00:31:37 np0000001578 sudo[2436]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:31:37 np0000001578 sudo[2436]: pam_unix(sudo:session): session closed for user root May 28 00:31:38 np0000001578 sudo[2454]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-fmzeyjussdhlchqumpawynwfnxfzfgsc ; /usr/bin/python3' May 28 00:31:38 np0000001578 sudo[2454]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:31:38 np0000001578 sudo[2454]: pam_unix(sudo:session): session closed for user root May 28 00:31:38 np0000001578 sudo[2463]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-wrmdiwyxwqtmweceploaplanlbtedonr ; /usr/bin/python3' May 28 00:31:38 np0000001578 sudo[2463]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:31:38 np0000001578 sudo[2463]: pam_unix(sudo:session): session closed for user root May 28 00:31:42 np0000001578 sudo[2477]: ubuntu : PWD=/home/ubuntu ; USER=stack ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-pjmclkbmajkhgpbyukhmpgxcqrbgmlhu ; /usr/bin/python3' May 28 00:31:42 np0000001578 sudo[2477]: pam_unix(sudo:session): session opened for user stack(uid=1002) by ubuntu(uid=1000) May 28 00:31:42 np0000001578 sudo[2477]: pam_unix(sudo:session): session closed for user stack May 28 00:31:43 np0000001578 sudo[2532]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-bljnumtgoeeydixtobtruomnncaelolt ; /usr/bin/python3' May 28 00:31:43 np0000001578 sudo[2532]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:31:44 np0000001578 sudo[2532]: pam_unix(sudo:session): session closed for user root May 28 00:31:44 np0000001578 sudo[2537]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-omfpviylwvrknvwohrllrrrsonlhdtuk ; /usr/bin/python3' May 28 00:31:44 np0000001578 sudo[2537]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:31:44 np0000001578 sudo[2537]: pam_unix(sudo:session): session closed for user root May 28 00:31:44 np0000001578 sudo[2542]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-olkddtatzxuyjjqjmbskropruwbcylie ; /usr/bin/python3' May 28 00:31:44 np0000001578 sudo[2542]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:31:45 np0000001578 sudo[2542]: pam_unix(sudo:session): session closed for user root May 28 00:31:45 np0000001578 sudo[2679]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-ruduowdocrggyqbzfqafwavakjidotmb ; /usr/bin/python3' May 28 00:31:45 np0000001578 sudo[2679]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:31:45 np0000001578 sudo[2679]: pam_unix(sudo:session): session closed for user root May 28 00:31:45 np0000001578 sudo[2728]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-liwhiqpnddjponirfpsyldfthveuxlht ; /usr/bin/python3' May 28 00:31:45 np0000001578 sudo[2728]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:31:46 np0000001578 sudo[2728]: pam_unix(sudo:session): session closed for user root May 28 00:31:46 np0000001578 sudo[2776]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-sciniapjrogdcdajzryeuuvhqoqcpmzi ; /usr/bin/python3' May 28 00:31:46 np0000001578 sudo[2776]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:31:46 np0000001578 sudo[2776]: pam_unix(sudo:session): session closed for user root May 28 00:31:46 np0000001578 sudo[2823]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-zgtusxbycigyyopsllfcmhnfuvdzruzz ; /usr/bin/python3' May 28 00:31:46 np0000001578 sudo[2823]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:31:47 np0000001578 sudo[2823]: pam_unix(sudo:session): session closed for user root May 28 00:31:48 np0000001578 sudo[2885]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-yloqgpxggxfevlimcagwrkjqzskgczto ; /usr/bin/python3' May 28 00:31:48 np0000001578 sudo[2885]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:31:48 np0000001578 sudo[2885]: pam_unix(sudo:session): session closed for user root May 28 00:31:50 np0000001578 sudo[2954]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-bjzpxfqfdtasgsrfqcdmqwzdfwleinyg ; /usr/bin/python3' May 28 00:31:50 np0000001578 sudo[2954]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:32:20 np0000001578 sudo[2954]: pam_unix(sudo:session): session closed for user root May 28 00:32:22 np0000001578 sudo[8033]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-egveavvqmqqvnpkterecnmznbzumvvgy ; /usr/bin/python3' May 28 00:32:22 np0000001578 sudo[8033]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:32:23 np0000001578 sudo[8033]: pam_unix(sudo:session): session closed for user root May 28 00:32:23 np0000001578 sudo[8041]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-aysmbjyvdyatosjdzqganjpttcwjsxym ; /usr/bin/python3' May 28 00:32:23 np0000001578 sudo[8041]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:32:23 np0000001578 sudo[8041]: pam_unix(sudo:session): session closed for user root May 28 00:34:05 np0000001578 kernel: pci 0000:07:00.0: [1af4:1041] type 00 class 0x020000 PCIe Endpoint May 28 00:34:05 np0000001578 kernel: pci 0000:07:00.0: BAR 1 [mem 0x00000000-0x00000fff] May 28 00:34:05 np0000001578 kernel: pci 0000:07:00.0: BAR 4 [mem 0x00000000-0x00003fff 64bit pref] May 28 00:34:05 np0000001578 kernel: pci 0000:07:00.0: ROM [mem 0x00000000-0x0007ffff pref] May 28 00:34:05 np0000001578 kernel: pci 0000:07:00.0: ROM [mem 0xfe000000-0xfe07ffff pref]: assigned May 28 00:34:05 np0000001578 kernel: pci 0000:07:00.0: BAR 4 [mem 0xc160000000-0xc160003fff 64bit pref]: assigned May 28 00:34:05 np0000001578 kernel: pci 0000:07:00.0: BAR 1 [mem 0xfe080000-0xfe080fff]: assigned May 28 00:34:05 np0000001578 kernel: virtio-pci 0000:07:00.0: enabling device (0000 -> 0002) May 28 00:34:05 np0000001578 kernel: virtio_net virtio5 enp7s0: renamed from eth0 May 28 00:34:16 np0000001578 kernel: pci 0000:08:00.0: [1af4:1041] type 00 class 0x020000 PCIe Endpoint May 28 00:34:16 np0000001578 kernel: pci 0000:08:00.0: BAR 1 [mem 0x00000000-0x00000fff] May 28 00:34:16 np0000001578 kernel: pci 0000:08:00.0: BAR 4 [mem 0x00000000-0x00003fff 64bit pref] May 28 00:34:16 np0000001578 kernel: pci 0000:08:00.0: ROM [mem 0x00000000-0x0007ffff pref] May 28 00:34:16 np0000001578 kernel: pci 0000:08:00.0: ROM [mem 0xfde00000-0xfde7ffff pref]: assigned May 28 00:34:16 np0000001578 kernel: pci 0000:08:00.0: BAR 4 [mem 0xc140000000-0xc140003fff 64bit pref]: assigned May 28 00:34:16 np0000001578 kernel: pci 0000:08:00.0: BAR 1 [mem 0xfde80000-0xfde80fff]: assigned May 28 00:34:16 np0000001578 kernel: virtio-pci 0000:08:00.0: enabling device (0000 -> 0002) May 28 00:34:16 np0000001578 kernel: virtio_net virtio6 enp8s0: renamed from eth0 May 28 00:34:52 np0000001578 sudo[8128]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-jlvnxgdapnbzvzzfsccackqwuluecyyh ; /usr/bin/python3' May 28 00:34:52 np0000001578 sudo[8128]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:34:52 np0000001578 sudo[8128]: pam_unix(sudo:session): session closed for user root May 28 00:34:52 np0000001578 sudo[8137]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-cspvlpowztpeipqhnjtnbdisvjtcltcy ; /usr/bin/python3' May 28 00:34:52 np0000001578 sudo[8137]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:34:53 np0000001578 sudo[8137]: pam_unix(sudo:session): session closed for user root May 28 00:34:53 np0000001578 sudo[8146]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-gtsfkljulmggnnpssuogkbveufezashz ; /usr/bin/python3' May 28 00:34:53 np0000001578 sudo[8146]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:34:54 np0000001578 sudo[8146]: pam_unix(sudo:session): session closed for user root May 28 00:34:54 np0000001578 sudo[8201]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-uixvnpfxmloyfqubsclsxvbbdqsikdtc ; /usr/bin/python3' May 28 00:34:54 np0000001578 sudo[8201]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:34:55 np0000001578 kernel: virtio_net virtio5 iscsi0: renamed from enp7s0 May 28 00:34:55 np0000001578 kernel: virtio_net virtio6 iscsi1: renamed from enp8s0 May 28 00:34:55 np0000001578 kernel: 8021q: adding VLAN 0 to HW filter on device iscsi0 May 28 00:34:55 np0000001578 kernel: 8021q: adding VLAN 0 to HW filter on device iscsi1 May 28 00:34:55 np0000001578 sudo[8201]: pam_unix(sudo:session): session closed for user root May 28 00:35:33 np0000001578 kernel: pci 0000:09:00.0: [1af4:1041] type 00 class 0x020000 PCIe Endpoint May 28 00:35:33 np0000001578 kernel: pci 0000:09:00.0: BAR 1 [mem 0x00000000-0x00000fff] May 28 00:35:33 np0000001578 kernel: pci 0000:09:00.0: BAR 4 [mem 0x00000000-0x00003fff 64bit pref] May 28 00:35:33 np0000001578 kernel: pci 0000:09:00.0: ROM [mem 0x00000000-0x0007ffff pref] May 28 00:35:33 np0000001578 kernel: pci 0000:09:00.0: ROM [mem 0xfdc00000-0xfdc7ffff pref]: assigned May 28 00:35:33 np0000001578 kernel: pci 0000:09:00.0: BAR 4 [mem 0xc120000000-0xc120003fff 64bit pref]: assigned May 28 00:35:33 np0000001578 kernel: pci 0000:09:00.0: BAR 1 [mem 0xfdc80000-0xfdc80fff]: assigned May 28 00:35:33 np0000001578 kernel: virtio-pci 0000:09:00.0: enabling device (0000 -> 0002) May 28 00:35:33 np0000001578 kernel: virtio_net virtio7 enp9s0: renamed from eth0 May 28 00:35:46 np0000001578 kernel: pci 0000:0a:00.0: [1af4:1041] type 00 class 0x020000 PCIe Endpoint May 28 00:35:46 np0000001578 kernel: pci 0000:0a:00.0: BAR 1 [mem 0x00000000-0x00000fff] May 28 00:35:46 np0000001578 kernel: pci 0000:0a:00.0: BAR 4 [mem 0x00000000-0x00003fff 64bit pref] May 28 00:35:46 np0000001578 kernel: pci 0000:0a:00.0: ROM [mem 0x00000000-0x0007ffff pref] May 28 00:35:46 np0000001578 kernel: pci 0000:0a:00.0: ROM [mem 0xfda00000-0xfda7ffff pref]: assigned May 28 00:35:46 np0000001578 kernel: pci 0000:0a:00.0: BAR 4 [mem 0xc100000000-0xc100003fff 64bit pref]: assigned May 28 00:35:46 np0000001578 kernel: pci 0000:0a:00.0: BAR 1 [mem 0xfda80000-0xfda80fff]: assigned May 28 00:35:46 np0000001578 kernel: virtio-pci 0000:0a:00.0: enabling device (0000 -> 0002) May 28 00:35:46 np0000001578 kernel: virtio_net virtio8 enp10s0: renamed from eth0 May 28 00:35:58 np0000001578 kernel: pci 0000:0b:00.0: [1af4:1041] type 00 class 0x020000 PCIe Endpoint May 28 00:35:58 np0000001578 kernel: pci 0000:0b:00.0: BAR 1 [mem 0x00000000-0x00000fff] May 28 00:35:58 np0000001578 kernel: pci 0000:0b:00.0: BAR 4 [mem 0x00000000-0x00003fff 64bit pref] May 28 00:35:58 np0000001578 kernel: pci 0000:0b:00.0: ROM [mem 0x00000000-0x0007ffff pref] May 28 00:35:58 np0000001578 kernel: pci 0000:0b:00.0: ROM [mem 0xfd800000-0xfd87ffff pref]: assigned May 28 00:35:58 np0000001578 kernel: pci 0000:0b:00.0: BAR 4 [mem 0xc0e0000000-0xc0e0003fff 64bit pref]: assigned May 28 00:35:58 np0000001578 kernel: pci 0000:0b:00.0: BAR 1 [mem 0xfd880000-0xfd880fff]: assigned May 28 00:35:58 np0000001578 kernel: virtio-pci 0000:0b:00.0: enabling device (0000 -> 0002) May 28 00:35:58 np0000001578 kernel: virtio_net virtio9 enp11s0: renamed from eth0 May 28 00:36:30 np0000001578 kernel: scsi 0:0:0:1: Direct-Access QEMU QEMU HARDDISK 2.5+ PQ: 0 ANSI: 5 May 28 00:36:30 np0000001578 kernel: sd 0:0:0:1: Attached scsi generic sg1 type 0 May 28 00:36:30 np0000001578 kernel: sd 0:0:0:1: Power-on or device reset occurred May 28 00:36:30 np0000001578 kernel: sd 0:0:0:1: LUN assignments on this target have changed. The Linux SCSI layer does not automatically remap LUN assignments. May 28 00:36:30 np0000001578 kernel: sd 0:0:0:1: [sdb] 482344960 512-byte logical blocks: (247 GB/230 GiB) May 28 00:36:30 np0000001578 kernel: sd 0:0:0:1: [sdb] Write Protect is off May 28 00:36:30 np0000001578 kernel: sd 0:0:0:1: [sdb] Mode Sense: 63 00 00 08 May 28 00:36:30 np0000001578 kernel: sd 0:0:0:1: [sdb] Write cache: enabled, read cache: enabled, doesn't support DPO or FUA May 28 00:36:30 np0000001578 kernel: sd 0:0:0:1: [sdb] Attached SCSI disk May 28 00:36:31 np0000001578 sudo[8410]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-bqtqyxzsbtubdtobvvkalublyrxuzvqy ; /usr/bin/python3' May 28 00:36:31 np0000001578 sudo[8410]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:36:32 np0000001578 sudo[8410]: pam_unix(sudo:session): session closed for user root May 28 00:36:32 np0000001578 sudo[8419]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-piorlfktifbllesqlwltegdmektvsyew ; /usr/bin/python3' May 28 00:36:32 np0000001578 sudo[8419]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:36:32 np0000001578 sudo[8419]: pam_unix(sudo:session): session closed for user root May 28 00:36:32 np0000001578 sudo[8427]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-pbywarridmtpltlcrzzlyldkjzmhpevg ; /usr/bin/python3' May 28 00:36:32 np0000001578 sudo[8427]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:36:33 np0000001578 sudo[8427]: pam_unix(sudo:session): session closed for user root May 28 00:36:33 np0000001578 sudo[8480]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-odtlizhwqfypvpchnpevepyttcinftvp ; /usr/bin/python3' May 28 00:36:33 np0000001578 sudo[8480]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:36:34 np0000001578 kernel: virtio_net virtio7 sp-api: renamed from enp9s0 May 28 00:36:34 np0000001578 kernel: virtio_net virtio8 sp0: renamed from enp10s0 May 28 00:36:34 np0000001578 kernel: virtio_net virtio9 sp1: renamed from enp11s0 May 28 00:36:34 np0000001578 kernel: 8021q: adding VLAN 0 to HW filter on device sp-api May 28 00:36:34 np0000001578 kernel: 8021q: adding VLAN 0 to HW filter on device sp1 May 28 00:36:34 np0000001578 kernel: 8021q: adding VLAN 0 to HW filter on device sp0 May 28 00:36:34 np0000001578 sudo[8480]: pam_unix(sudo:session): session closed for user root May 28 00:37:27 np0000001578 sudo[8718]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-xzdvwfbicipfisecoxxpafzyebtovmic ; cat /etc/os-release' May 28 00:37:27 np0000001578 sudo[8718]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:37:27 np0000001578 sudo[8718]: pam_unix(sudo:session): session closed for user root May 28 00:37:27 np0000001578 sudo[8722]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-xfyvfjkehfiwfuzlhzkrkwzbyjoazbwu ; apt-get update && env DEBIAN_FRONTEND=noninteractive apt-get install -y python3' May 28 00:37:27 np0000001578 sudo[8722]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:37:30 np0000001578 sudo[8722]: pam_unix(sudo:session): session closed for user root May 28 00:37:31 np0000001578 sudo[9124]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-arjwezhmgxttgrvyroujprdzkaffbkxf ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928651.5354147-10068-191683979034166/AnsiballZ_apt.py' May 28 00:37:31 np0000001578 sudo[9124]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:37:33 np0000001578 sudo[9124]: pam_unix(sudo:session): session closed for user root May 28 00:37:33 np0000001578 sudo[9410]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-jaryuspzwmlutplbkotmhmidbqnekvkv ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928653.5868938-10076-171774533118180/AnsiballZ_apt.py' May 28 00:37:33 np0000001578 sudo[9410]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:37:34 np0000001578 sudo[9410]: pam_unix(sudo:session): session closed for user root May 28 00:37:35 np0000001578 sudo[9440]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-bwybmanqewjggbrjbwhgpeojeginnfwf ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928654.8335555-10085-162584902763060/AnsiballZ_get_url.py' May 28 00:37:35 np0000001578 sudo[9440]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:37:35 np0000001578 sudo[9440]: pam_unix(sudo:session): session closed for user root May 28 00:37:35 np0000001578 sudo[9463]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-yfxwbvmbiwzdiqvgxiwyscbqlxorqikt ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928655.4745317-10093-27337036511530/AnsiballZ_stat.py' May 28 00:37:35 np0000001578 sudo[9463]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:37:35 np0000001578 sudo[9463]: pam_unix(sudo:session): session closed for user root May 28 00:37:36 np0000001578 sudo[9477]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-slvsdakwcfnyhhljoyrvpqqtrechnpdq ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928655.4745317-10093-27337036511530/AnsiballZ_copy.py' May 28 00:37:36 np0000001578 sudo[9477]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:37:36 np0000001578 sudo[9477]: pam_unix(sudo:session): session closed for user root May 28 00:37:36 np0000001578 sudo[9500]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-zzrfwnoxpcbpiusrdigawpchuxsiqfta ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928656.4554255-10108-155159902548745/AnsiballZ_apt.py' May 28 00:37:36 np0000001578 sudo[9500]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:37:40 np0000001578 sudo[9500]: pam_unix(sudo:session): session closed for user root May 28 00:37:40 np0000001578 sudo[9830]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-agrmnbswcxhshggnjjxtawmmmwlnhavr ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928660.8558028-10117-23417322823726/AnsiballZ_apt.py' May 28 00:37:40 np0000001578 sudo[9830]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:37:51 np0000001578 sudo[9830]: pam_unix(sudo:session): session closed for user root May 28 00:37:52 np0000001578 sudo[10000]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-oyffbiosqgxykrhikbwmcldqpbwrjyyv ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928672.1788032-10140-206494439960173/AnsiballZ_apt.py' May 28 00:37:52 np0000001578 sudo[10000]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:37:54 np0000001578 sudo[10000]: pam_unix(sudo:session): session closed for user root May 28 00:37:54 np0000001578 sudo[10251]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-oelkmwynfcbiuzltbmlhfxmzlhlzvkho ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928674.1921146-10149-166531328995174/AnsiballZ_apt.py' May 28 00:37:54 np0000001578 sudo[10251]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:37:55 np0000001578 sudo[10251]: pam_unix(sudo:session): session closed for user root May 28 00:37:55 np0000001578 sudo[10280]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-nvrdlvgpghihmuikuejzxzkpynwphivv ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928675.3079123-10158-166236672890356/AnsiballZ_apt.py' May 28 00:37:55 np0000001578 sudo[10280]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:38:09 np0000001578 kernel: Key type psk registered May 28 00:38:11 np0000001578 kernel: audit: type=1400 audit(1779928691.982:125): apparmor="STATUS" operation="profile_load" profile="unconfined" name="/usr/sbin/chronyd" pid=11952 comm="apparmor_parser" May 28 00:38:16 np0000001578 sudo[10280]: pam_unix(sudo:session): session closed for user root May 28 00:38:16 np0000001578 sudo[12220]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-zzybmetbvfzbcueqvbhsldpazxpyvysi ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928696.799816-10166-71515262621410/AnsiballZ_stat.py' May 28 00:38:16 np0000001578 sudo[12220]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:38:17 np0000001578 sudo[12220]: pam_unix(sudo:session): session closed for user root May 28 00:38:17 np0000001578 sudo[12234]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-ugybtgphaionhcbmrevogawhgvpnfdqy ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928696.799816-10166-71515262621410/AnsiballZ_copy.py' May 28 00:38:17 np0000001578 sudo[12234]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:38:17 np0000001578 sudo[12234]: pam_unix(sudo:session): session closed for user root May 28 00:38:17 np0000001578 sudo[12257]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-gvbjjmsvvutaygxdvflslxbwadwfvqks ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928697.4641602-10181-154185778841922/AnsiballZ_mount.py' May 28 00:38:17 np0000001578 sudo[12257]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:38:17 np0000001578 sudo[12257]: pam_unix(sudo:session): session closed for user root May 28 00:38:18 np0000001578 sudo[12281]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-qijgslemkdrgndwgcclmjuqabxlcjbls ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928698.0374339-10189-111191143864371/AnsiballZ_command.py' May 28 00:38:18 np0000001578 sudo[12281]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:38:18 np0000001578 sudo[12281]: pam_unix(sudo:session): session closed for user root May 28 00:38:18 np0000001578 sudo[12305]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-jqhemhldxlhtyafkcsfrucnlcvblyivo ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928698.5859947-10197-186801231884800/AnsiballZ_lineinfile.py' May 28 00:38:18 np0000001578 sudo[12305]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:38:19 np0000001578 sudo[12305]: pam_unix(sudo:session): session closed for user root May 28 00:38:20 np0000001578 sudo[12390]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-arikkweyhhiwrkefwsafmrzupwgqmfbv ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928700.3499913-10228-121444017849263/AnsiballZ_lineinfile.py' May 28 00:38:20 np0000001578 sudo[12390]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:38:20 np0000001578 sudo[12390]: pam_unix(sudo:session): session closed for user root May 28 00:38:24 np0000001578 sudo[12885]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-yweojuimnzpjttqbvogqdtwracmppxyb ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928704.1784446-10247-111144163677636/AnsiballZ_systemd.py' May 28 00:38:24 np0000001578 sudo[12885]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:38:24 np0000001578 sudo[12885]: pam_unix(sudo:session): session closed for user root May 28 00:38:27 np0000001578 sudo[12933]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-thumxiptwfrgdzpaoybuupzoaadtflhe ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928707.1261914-10268-174278037624052/AnsiballZ_lineinfile.py' May 28 00:38:27 np0000001578 sudo[12933]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:38:27 np0000001578 sudo[12933]: pam_unix(sudo:session): session closed for user root May 28 00:38:27 np0000001578 sudo[12956]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-oacpffurfkiwhnskjvlpeoqzfzuwqesa ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928707.4531639-10268-268879041433141/AnsiballZ_lineinfile.py' May 28 00:38:27 np0000001578 sudo[12956]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:38:27 np0000001578 sudo[12956]: pam_unix(sudo:session): session closed for user root May 28 00:38:27 np0000001578 sudo[12979]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-ksowwdogthvzcntnzfeewhkfmtqpqnjm ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928707.8120944-10283-127710570302311/AnsiballZ_systemd.py' May 28 00:38:27 np0000001578 sudo[12979]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:38:28 np0000001578 sudo[12979]: pam_unix(sudo:session): session closed for user root May 28 00:38:28 np0000001578 sudo[13049]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-oustmwqckispoejmacpjyjygyjcmvhtu ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928708.655638-10283-53149273785950/AnsiballZ_systemd.py' May 28 00:38:28 np0000001578 sudo[13049]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:38:29 np0000001578 sudo[13049]: pam_unix(sudo:session): session closed for user root May 28 00:38:29 np0000001578 sudo[13076]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-xashxwxaibeeainshtzgqlrlrsefkycq ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928709.2183409-10298-98782943735163/AnsiballZ_lineinfile.py' May 28 00:38:29 np0000001578 sudo[13076]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:38:29 np0000001578 sudo[13076]: pam_unix(sudo:session): session closed for user root May 28 00:38:29 np0000001578 sudo[13099]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-abfqgoafwjrlztwhbcuoxfanzkqyemoz ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928709.623669-10306-99494585853397/AnsiballZ_systemd.py' May 28 00:38:29 np0000001578 sudo[13099]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:38:30 np0000001578 sudo[13099]: pam_unix(sudo:session): session closed for user root May 28 00:38:31 np0000001578 sudo[13278]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-ebvwirlshdabawqsyeauyacymnjfqrhb ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928711.7307067-10327-123468451767256/AnsiballZ_stat.py' May 28 00:38:31 np0000001578 sudo[13278]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:38:32 np0000001578 sudo[13278]: pam_unix(sudo:session): session closed for user root May 28 00:38:32 np0000001578 sudo[13292]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-oeulohsqgncwpucylryadqrtenmfekts ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928711.7307067-10327-123468451767256/AnsiballZ_copy.py' May 28 00:38:32 np0000001578 sudo[13292]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:38:32 np0000001578 sudo[13292]: pam_unix(sudo:session): session closed for user root May 28 00:38:33 np0000001578 sudo[13335]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-rcqenyhvakndbxkjqwfesrwsbjehxjbx ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928713.010122-10350-93160281563147/AnsiballZ_file.py' May 28 00:38:33 np0000001578 sudo[13335]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:38:33 np0000001578 sudo[13335]: pam_unix(sudo:session): session closed for user root May 28 00:38:33 np0000001578 sudo[13358]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-vnmwleatcajazslgvecxlgwrlrvfcmiw ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928713.3445828-10350-24441560775126/AnsiballZ_file.py' May 28 00:38:33 np0000001578 sudo[13358]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:38:33 np0000001578 sudo[13358]: pam_unix(sudo:session): session closed for user root May 28 00:38:33 np0000001578 sudo[13381]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-wpgxzbsobnjkrebjwctnyzvteazupwkq ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928713.6784291-10350-29834058266873/AnsiballZ_file.py' May 28 00:38:33 np0000001578 sudo[13381]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:38:33 np0000001578 sudo[13381]: pam_unix(sudo:session): session closed for user root May 28 00:38:34 np0000001578 sudo[13404]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-lzewdfamyscjefavktteuxejgtvishnd ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928714.0040324-10350-261557372889907/AnsiballZ_file.py' May 28 00:38:34 np0000001578 sudo[13404]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:38:34 np0000001578 sudo[13404]: pam_unix(sudo:session): session closed for user root May 28 00:38:34 np0000001578 sudo[13427]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-buvfnurxalttmhfyjmjwyhuazwageexr ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928714.3637018-10350-259214635602093/AnsiballZ_file.py' May 28 00:38:34 np0000001578 sudo[13427]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:38:34 np0000001578 sudo[13427]: pam_unix(sudo:session): session closed for user root May 28 00:38:35 np0000001578 sudo[13450]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-myzwakhdxzttnxiwkgojjxxfyhefwxeu ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928715.0952246-10392-265714930407624/AnsiballZ_apt.py' May 28 00:38:35 np0000001578 sudo[13450]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:38:36 np0000001578 sudo[13450]: pam_unix(sudo:session): session closed for user root May 28 00:38:36 np0000001578 sudo[13479]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-ifdtcoplirhpdvpcyddfgsuevcsmwzsd ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928716.298357-10401-96579823342789/AnsiballZ_apt.py' May 28 00:38:36 np0000001578 sudo[13479]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:38:37 np0000001578 sudo[13479]: pam_unix(sudo:session): session closed for user root May 28 00:38:38 np0000001578 sudo[13548]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-atlhgpcgndkwpcfanjhfpiyqdzelapnp ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928718.8177352-10433-267082927957213/AnsiballZ_stat.py' May 28 00:38:38 np0000001578 sudo[13548]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:38:39 np0000001578 sudo[13548]: pam_unix(sudo:session): session closed for user root May 28 00:38:39 np0000001578 sudo[13562]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-glcqtsqutksumnxscpkcuproxoglqeed ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928718.8177352-10433-267082927957213/AnsiballZ_copy.py' May 28 00:38:39 np0000001578 sudo[13562]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:38:39 np0000001578 sudo[13562]: pam_unix(sudo:session): session closed for user root May 28 00:38:39 np0000001578 sudo[13585]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-mgdnczbrnnmmehouwmtjtagrlbwhxvqk ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928719.5385072-10448-148212572795268/AnsiballZ_command.py' May 28 00:38:39 np0000001578 sudo[13585]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:38:40 np0000001578 sudo[13585]: pam_unix(sudo:session): session closed for user root May 28 00:38:40 np0000001578 sudo[13610]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-bnieqpsnwzasgglgciyaiyxagtggcyhc ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928720.670012-10456-231909675943064/AnsiballZ_file.py' May 28 00:38:40 np0000001578 sudo[13610]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:38:40 np0000001578 sudo[13610]: pam_unix(sudo:session): session closed for user root May 28 00:38:41 np0000001578 sudo[13634]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-gnkdfnsxkeoszugvqvemmwdviosxqvdd ; ANSIBLE_ASYNC_DIR=\'~/.ansible_async\' /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928721.5319662-10490-93621505265519/async_wrapper.py j96244730064 1000 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928721.5319662-10490-93621505265519/AnsiballZ_command.py _' May 28 00:38:41 np0000001578 sudo[13634]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:38:42 np0000001578 sudo[13634]: pam_unix(sudo:session): session closed for user root May 28 00:38:42 np0000001578 sudo[13841]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-tupalisuhuuzersgqqahjetinwltoand ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928722.7379827-10515-22150938201771/AnsiballZ_async_status.py' May 28 00:38:42 np0000001578 sudo[13841]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:38:43 np0000001578 sudo[13841]: pam_unix(sudo:session): session closed for user root May 28 00:38:48 np0000001578 sudo[14358]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-gasslbpgfjccrvvxsjzehiamwgggtoiz ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928728.2724922-10515-151150139872400/AnsiballZ_async_status.py' May 28 00:38:48 np0000001578 sudo[14358]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:38:48 np0000001578 sudo[14358]: pam_unix(sudo:session): session closed for user root May 28 00:38:53 np0000001578 sudo[14772]: ubuntu : TTY=pts/1 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-jrmxvcuxsruapvdxdgnsaoonhrdhfizo ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928733.6506875-10515-108491352785334/AnsiballZ_async_status.py' May 28 00:38:53 np0000001578 sudo[14772]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:38:53 np0000001578 sudo[14772]: pam_unix(sudo:session): session closed for user root May 28 00:38:59 np0000001578 sudo[14815]: ubuntu : TTY=pts/1 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-ifuxlpxfckdditikzbxetauyrthymqcs ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928739.0245852-10515-79529991211065/AnsiballZ_async_status.py' May 28 00:38:59 np0000001578 sudo[14815]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:38:59 np0000001578 sudo[14815]: pam_unix(sudo:session): session closed for user root May 28 00:39:04 np0000001578 sudo[15690]: ubuntu : TTY=pts/1 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-nmemokoeizutmyvmggzmimbhzsdaklcl ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928744.4295459-10515-131464252005573/AnsiballZ_async_status.py' May 28 00:39:04 np0000001578 sudo[15690]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:39:04 np0000001578 sudo[15690]: pam_unix(sudo:session): session closed for user root May 28 00:39:09 np0000001578 sudo[17947]: ubuntu : TTY=pts/1 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-vphuxdlubnfxovpeihfaidfkklxougyb ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928749.8098488-10515-91452511509080/AnsiballZ_async_status.py' May 28 00:39:09 np0000001578 sudo[17947]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:39:10 np0000001578 sudo[17947]: pam_unix(sudo:session): session closed for user root May 28 00:39:13 np0000001578 kernel: audit: type=1400 audit(1779928753.938:126): apparmor="STATUS" operation="profile_replace" info="same as current profile, skipping" profile="unconfined" name="rsyslogd" pid=20180 comm="apparmor_parser" May 28 00:39:15 np0000001578 sudo[20265]: ubuntu : TTY=pts/1 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-yhcslahkawkdoyvltmrafohpschzoisv ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928755.2181284-10515-272502629492914/AnsiballZ_async_status.py' May 28 00:39:15 np0000001578 sudo[20265]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:39:15 np0000001578 sudo[20265]: pam_unix(sudo:session): session closed for user root May 28 00:39:20 np0000001578 sudo[23990]: ubuntu : TTY=pts/1 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-cfixziyrcqxsvaoxdtxlqczagxvzplwt ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928760.6058621-10515-125714645590106/AnsiballZ_async_status.py' May 28 00:39:20 np0000001578 sudo[23990]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:39:20 np0000001578 sudo[23990]: pam_unix(sudo:session): session closed for user root May 28 00:39:26 np0000001578 sudo[27857]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-bqijpalyswvhcyvxbrytpbrllnwyfvga ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928766.0135193-10515-254520077985569/AnsiballZ_async_status.py' May 28 00:39:26 np0000001578 sudo[27857]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:39:26 np0000001578 sudo[27857]: pam_unix(sudo:session): session closed for user root May 28 00:39:31 np0000001578 sudo[28193]: ubuntu : TTY=pts/1 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-ahdvupkdhadchalzmidsvtmmdvvpmbjh ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928771.3915472-10515-190537380528077/AnsiballZ_async_status.py' May 28 00:39:31 np0000001578 sudo[28193]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:39:31 np0000001578 sudo[28193]: pam_unix(sudo:session): session closed for user root May 28 00:39:36 np0000001578 kernel: audit: type=1400 audit(1779928776.773:127): apparmor="STATUS" operation="profile_replace" info="same as current profile, skipping" profile="unconfined" name="rsyslogd" pid=28497 comm="apparmor_parser" May 28 00:39:36 np0000001578 sudo[28513]: ubuntu : TTY=pts/1 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-vawjrzrpivnhjgtpultybbajwghfjjho ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928776.7395735-10515-27396440502969/AnsiballZ_async_status.py' May 28 00:39:36 np0000001578 sudo[28513]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:39:37 np0000001578 sudo[28513]: pam_unix(sudo:session): session closed for user root May 28 00:39:42 np0000001578 sudo[28739]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-lgzjhyaxajfalgltwtrbdkobklqszbpl ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928782.12097-10515-163049230833483/AnsiballZ_async_status.py' May 28 00:39:42 np0000001578 sudo[28739]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:39:42 np0000001578 sudo[28739]: pam_unix(sudo:session): session closed for user root May 28 00:39:43 np0000001578 kernel: audit: type=1400 audit(1779928783.135:128): apparmor="STATUS" operation="profile_replace" profile="unconfined" name="tcpdump" pid=28749 comm="apparmor_parser" May 28 00:39:47 np0000001578 sudo[32299]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-enawpbetnnwjyhtgpcfhfoqmdfpckhcn ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928787.4796782-10515-221959506014192/AnsiballZ_async_status.py' May 28 00:39:47 np0000001578 sudo[32299]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:39:47 np0000001578 sudo[32299]: pam_unix(sudo:session): session closed for user root May 28 00:39:52 np0000001578 sudo[35313]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-acxhzexlvdbqgatwtciykjueqqmukjqc ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928792.8445215-10515-120675300782329/AnsiballZ_async_status.py' May 28 00:39:52 np0000001578 sudo[35313]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:39:53 np0000001578 sudo[35313]: pam_unix(sudo:session): session closed for user root May 28 00:39:58 np0000001578 sudo[36896]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-kncmeiweknchncmhfxvvervzrliynroe ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928798.2529972-10515-25669177138/AnsiballZ_async_status.py' May 28 00:39:58 np0000001578 sudo[36896]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:39:58 np0000001578 sudo[36896]: pam_unix(sudo:session): session closed for user root May 28 00:39:58 np0000001578 sudo[36919]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-onnxslbinqinikpewdhgewiouckajtvb ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928798.6427927-10636-126783581796436/AnsiballZ_systemd.py' May 28 00:39:58 np0000001578 sudo[36919]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:39:59 np0000001578 kernel: audit: type=1400 audit(1779928799.214:129): apparmor="STATUS" operation="profile_replace" info="same as current profile, skipping" profile="unconfined" name="rsyslogd" pid=36932 comm="apparmor_parser" May 28 00:39:59 np0000001578 sudo[36919]: pam_unix(sudo:session): session closed for user root May 28 00:39:59 np0000001578 sudo[36957]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-mwhlybljbicoovufmvgifiifptttvhjt ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928799.3825157-10644-31588595800735/AnsiballZ_command.py' May 28 00:39:59 np0000001578 sudo[36957]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:39:59 np0000001578 sudo[36957]: pam_unix(sudo:session): session closed for user root May 28 00:40:00 np0000001578 sudo[36983]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-yuqpwkddppsetetzjhylayupqhfxshas ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928799.957911-10653-36684908493551/AnsiballZ_command.py' May 28 00:40:00 np0000001578 sudo[36983]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:40:00 np0000001578 sudo[36983]: pam_unix(sudo:session): session closed for user root May 28 00:40:00 np0000001578 sudo[37010]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-vnkbfadhvkcljeduzkdzcxligpbxykzu ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928800.425028-10661-78047065954341/AnsiballZ_lineinfile.py' May 28 00:40:00 np0000001578 sudo[37010]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:40:00 np0000001578 sudo[37010]: pam_unix(sudo:session): session closed for user root May 28 00:40:01 np0000001578 sudo[37033]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-dfllxldryvssszvjifbawsfbdjmopguq ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928800.9798257-10672-107552190524594/AnsiballZ_command.py' May 28 00:40:01 np0000001578 sudo[37033]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:40:01 np0000001578 sudo[37033]: pam_unix(sudo:session): session closed for user root May 28 00:40:01 np0000001578 sudo[37082]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-kyskirzmmokdadmmeuwklhmrxncosqbz ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928801.5187638-10680-156829945344159/AnsiballZ_systemd.py' May 28 00:40:01 np0000001578 sudo[37082]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:40:02 np0000001578 sudo[37082]: pam_unix(sudo:session): session closed for user root May 28 00:40:02 np0000001578 sudo[37107]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-imxvhschwduleptwtlsjclgteokdbiwb ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928802.1828916-10691-150554466687392/AnsiballZ_stat.py' May 28 00:40:02 np0000001578 sudo[37107]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:40:02 np0000001578 sudo[37107]: pam_unix(sudo:session): session closed for user root May 28 00:40:02 np0000001578 sudo[37121]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-hbhjlazcannfwzjxffcsmutafgqcrlno ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928802.1828916-10691-150554466687392/AnsiballZ_copy.py' May 28 00:40:02 np0000001578 sudo[37121]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:40:02 np0000001578 sudo[37121]: pam_unix(sudo:session): session closed for user root May 28 00:40:03 np0000001578 sudo[37144]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-lykruawuliehlicekmjpcjatnxmcmwdn ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928802.9330719-10706-220557607134643/AnsiballZ_file.py' May 28 00:40:03 np0000001578 sudo[37144]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:40:03 np0000001578 sudo[37144]: pam_unix(sudo:session): session closed for user root May 28 00:40:03 np0000001578 sudo[37167]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-aigmemxvduslfytwzxlvxfuuzuerjqqa ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928803.3394501-10714-41409031495881/AnsiballZ_get_url.py' May 28 00:40:03 np0000001578 sudo[37167]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:40:03 np0000001578 sudo[37167]: pam_unix(sudo:session): session closed for user root May 28 00:40:04 np0000001578 sudo[37190]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-zonbbnjtpuisloqaveovvsfrznknlvvj ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928803.9674902-10722-117028250418606/AnsiballZ_file.py' May 28 00:40:04 np0000001578 sudo[37190]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:40:04 np0000001578 sudo[37190]: pam_unix(sudo:session): session closed for user root May 28 00:40:04 np0000001578 sudo[37213]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-nrqhbhtutcxwskzjyaojaibhjpvoojry ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928804.5349889-10733-11192876529894/AnsiballZ_stat.py' May 28 00:40:04 np0000001578 sudo[37213]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:40:04 np0000001578 sudo[37213]: pam_unix(sudo:session): session closed for user root May 28 00:40:05 np0000001578 sudo[37236]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-tgvptuxykkxvsdzteopcuvwekyiuwejs ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928804.9345124-10741-11643073080659/AnsiballZ_command.py' May 28 00:40:05 np0000001578 sudo[37236]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:40:05 np0000001578 sudo[37236]: pam_unix(sudo:session): session closed for user root May 28 00:40:06 np0000001578 sudo[37658]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-gohnlgnwqkehxnnlcacomkkufaayqzzd ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928806.2034252-10753-234031719252338/AnsiballZ_command.py' May 28 00:40:06 np0000001578 sudo[37658]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:40:19 np0000001578 sudo[37658]: pam_unix(sudo:session): session closed for user root May 28 00:40:19 np0000001578 sudo[45588]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-htjbqsbsahqtzakxayuyxsrmlonclgtj ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928819.2442675-10761-150114990117327/AnsiballZ_setup.py' May 28 00:40:19 np0000001578 sudo[45588]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:40:19 np0000001578 sudo[45588]: pam_unix(sudo:session): session closed for user root May 28 00:40:19 np0000001578 sudo[45627]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-jiowtftlagzqsvvwhjncfvatnqlzzqle ; cat /proc/sys/kernel/random/boot_id' May 28 00:40:19 np0000001578 sudo[45627]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:40:19 np0000001578 sudo[45627]: pam_unix(sudo:session): session closed for user root May 28 00:40:19 np0000001578 sudo[45637]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-pbdduyagwnqrulsexkyxjywzjuwqdehc ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928819.2442675-10761-150114990117327/AnsiballZ_find.py' May 28 00:40:19 np0000001578 sudo[45637]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:40:20 np0000001578 sudo[45637]: pam_unix(sudo:session): session closed for user root May 28 00:40:20 np0000001578 sudo[45643]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-lrrrhgpfptrdqlbnijyvltxjxogjsikj ; /sbin/shutdown -r 0 "Reboot initiated by Ansible"' May 28 00:40:20 np0000001578 sudo[45643]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:40:20 np0000001578 sudo[45643]: pam_unix(sudo:session): session closed for user root May 28 00:40:21 np0000001578 kernel: EXT4-fs (sda16): unmounting filesystem 7dc15ce9-d090-44d7-bb05-2a36d545a8e3. -- Boot 97c63292dfb54c84b25ede99e22c6e48 -- May 28 00:40:29 np0000001578 kernel: Linux version 6.8.0-117-generic (buildd@lcy02-amd64-102) (x86_64-linux-gnu-gcc-13 (Ubuntu 13.3.0-6ubuntu2~24.04.1) 13.3.0, GNU ld (GNU Binutils for Ubuntu) 2.42) #117-Ubuntu SMP PREEMPT_DYNAMIC Tue May 5 19:26:24 UTC 2026 (Ubuntu 6.8.0-117.117-generic 6.8.12) May 28 00:40:29 np0000001578 kernel: Command line: BOOT_IMAGE=/vmlinuz-6.8.0-117-generic root=UUID=8515de1c-ba7e-467b-adde-6d9f8a8dbc1f ro amd_pstate=guided video=vesafb:off nomodeset i915.modeset=0 libata.fua=1 swapaccount=1 usbcore.autosuspend=-1 vga=normal systemd.unified_cgroup_hierarchy=0 nofb systemd.legacy_systemd_cgroup_controller=1 console=tty1 console=ttyS0 crashkernel=1024M May 28 00:40:29 np0000001578 kernel: KERNEL supported cpus: May 28 00:40:29 np0000001578 kernel: Intel GenuineIntel May 28 00:40:29 np0000001578 kernel: AMD AuthenticAMD May 28 00:40:29 np0000001578 kernel: Hygon HygonGenuine May 28 00:40:29 np0000001578 kernel: Centaur CentaurHauls May 28 00:40:29 np0000001578 kernel: zhaoxin Shanghai May 28 00:40:29 np0000001578 kernel: BIOS-provided physical RAM map: May 28 00:40:29 np0000001578 kernel: BIOS-e820: [mem 0x0000000000000000-0x000000000009fbff] usable May 28 00:40:29 np0000001578 kernel: BIOS-e820: [mem 0x000000000009fc00-0x000000000009ffff] reserved May 28 00:40:29 np0000001578 kernel: BIOS-e820: [mem 0x00000000000f0000-0x00000000000fffff] reserved May 28 00:40:29 np0000001578 kernel: BIOS-e820: [mem 0x0000000000100000-0x000000007ffdafff] usable May 28 00:40:29 np0000001578 kernel: BIOS-e820: [mem 0x000000007ffdb000-0x000000007fffffff] reserved May 28 00:40:29 np0000001578 kernel: BIOS-e820: [mem 0x00000000b0000000-0x00000000bfffffff] reserved May 28 00:40:29 np0000001578 kernel: BIOS-e820: [mem 0x00000000fed1c000-0x00000000fed1ffff] reserved May 28 00:40:29 np0000001578 kernel: BIOS-e820: [mem 0x00000000feffc000-0x00000000feffffff] reserved May 28 00:40:29 np0000001578 kernel: BIOS-e820: [mem 0x00000000fffc0000-0x00000000ffffffff] reserved May 28 00:40:29 np0000001578 kernel: BIOS-e820: [mem 0x0000000100000000-0x000000067fffffff] usable May 28 00:40:29 np0000001578 kernel: BIOS-e820: [mem 0x000000fd00000000-0x000000ffffffffff] reserved May 28 00:40:29 np0000001578 kernel: NX (Execute Disable) protection: active May 28 00:40:29 np0000001578 kernel: APIC: Static calls initialized May 28 00:40:29 np0000001578 kernel: SMBIOS 3.0.0 present. May 28 00:40:29 np0000001578 kernel: DMI: OpenStack Foundation OpenStack Nova, BIOS 1.16.3-debian-1.16.3-2 04/01/2014 May 28 00:40:29 np0000001578 kernel: Hypervisor detected: KVM May 28 00:40:29 np0000001578 kernel: kvm-clock: Using msrs 4b564d01 and 4b564d00 May 28 00:40:29 np0000001578 kernel: kvm-clock: using sched offset of 731063942943 cycles May 28 00:40:29 np0000001578 kernel: clocksource: kvm-clock: mask: 0xffffffffffffffff max_cycles: 0x1cd42e4dffb, max_idle_ns: 881590591483 ns May 28 00:40:29 np0000001578 kernel: tsc: Detected 2395.498 MHz processor May 28 00:40:29 np0000001578 kernel: e820: update [mem 0x00000000-0x00000fff] usable ==> reserved May 28 00:40:29 np0000001578 kernel: e820: remove [mem 0x000a0000-0x000fffff] usable May 28 00:40:29 np0000001578 kernel: last_pfn = 0x680000 max_arch_pfn = 0x400000000 May 28 00:40:29 np0000001578 kernel: MTRR map: 4 entries (3 fixed + 1 variable; max 19), built from 8 variable MTRRs May 28 00:40:29 np0000001578 kernel: x86/PAT: Configuration [0-7]: WB WC UC- UC WB WP UC- WT May 28 00:40:29 np0000001578 kernel: last_pfn = 0x7ffdb max_arch_pfn = 0x400000000 May 28 00:40:29 np0000001578 kernel: found SMP MP-table at [mem 0x000f5380-0x000f538f] May 28 00:40:29 np0000001578 kernel: Using GB pages for direct mapping May 28 00:40:29 np0000001578 kernel: RAMDISK: [mem 0x344b3000-0x36250fff] May 28 00:40:29 np0000001578 kernel: ACPI: Early table checksum verification disabled May 28 00:40:29 np0000001578 kernel: ACPI: RSDP 0x00000000000F5340 000014 (v00 BOCHS ) May 28 00:40:29 np0000001578 kernel: ACPI: RSDT 0x000000007FFE3A81 000034 (v01 BOCHS BXPC 00000001 BXPC 00000001) May 28 00:40:29 np0000001578 kernel: ACPI: FACP 0x000000007FFE3859 0000F4 (v03 BOCHS BXPC 00000001 BXPC 00000001) May 28 00:40:29 np0000001578 kernel: ACPI: DSDT 0x000000007FFDFB00 003D59 (v01 BOCHS BXPC 00000001 BXPC 00000001) May 28 00:40:29 np0000001578 kernel: ACPI: FACS 0x000000007FFDFAC0 000040 May 28 00:40:29 np0000001578 kernel: ACPI: APIC 0x000000007FFE394D 0000D0 (v03 BOCHS BXPC 00000001 BXPC 00000001) May 28 00:40:29 np0000001578 kernel: ACPI: MCFG 0x000000007FFE3A1D 00003C (v01 BOCHS BXPC 00000001 BXPC 00000001) May 28 00:40:29 np0000001578 kernel: ACPI: WAET 0x000000007FFE3A59 000028 (v01 BOCHS BXPC 00000001 BXPC 00000001) May 28 00:40:29 np0000001578 kernel: ACPI: Reserving FACP table memory at [mem 0x7ffe3859-0x7ffe394c] May 28 00:40:29 np0000001578 kernel: ACPI: Reserving DSDT table memory at [mem 0x7ffdfb00-0x7ffe3858] May 28 00:40:29 np0000001578 kernel: ACPI: Reserving FACS table memory at [mem 0x7ffdfac0-0x7ffdfaff] May 28 00:40:29 np0000001578 kernel: ACPI: Reserving APIC table memory at [mem 0x7ffe394d-0x7ffe3a1c] May 28 00:40:29 np0000001578 kernel: ACPI: Reserving MCFG table memory at [mem 0x7ffe3a1d-0x7ffe3a58] May 28 00:40:29 np0000001578 kernel: ACPI: Reserving WAET table memory at [mem 0x7ffe3a59-0x7ffe3a80] May 28 00:40:29 np0000001578 kernel: No NUMA configuration found May 28 00:40:29 np0000001578 kernel: Faking a node at [mem 0x0000000000000000-0x000000067fffffff] May 28 00:40:29 np0000001578 kernel: NODE_DATA(0) allocated [mem 0x67ffd3000-0x67fffdfff] May 28 00:40:29 np0000001578 kernel: crashkernel reserved: 0x000000003f000000 - 0x000000007f000000 (1024 MB) May 28 00:40:29 np0000001578 kernel: Zone ranges: May 28 00:40:29 np0000001578 kernel: DMA [mem 0x0000000000001000-0x0000000000ffffff] May 28 00:40:29 np0000001578 kernel: DMA32 [mem 0x0000000001000000-0x00000000ffffffff] May 28 00:40:29 np0000001578 kernel: Normal [mem 0x0000000100000000-0x000000067fffffff] May 28 00:40:29 np0000001578 kernel: Device empty May 28 00:40:29 np0000001578 kernel: Movable zone start for each node May 28 00:40:29 np0000001578 kernel: Early memory node ranges May 28 00:40:29 np0000001578 kernel: node 0: [mem 0x0000000000001000-0x000000000009efff] May 28 00:40:29 np0000001578 kernel: node 0: [mem 0x0000000000100000-0x000000007ffdafff] May 28 00:40:29 np0000001578 kernel: node 0: [mem 0x0000000100000000-0x000000067fffffff] May 28 00:40:29 np0000001578 kernel: Initmem setup node 0 [mem 0x0000000000001000-0x000000067fffffff] May 28 00:40:29 np0000001578 kernel: On node 0, zone DMA: 1 pages in unavailable ranges May 28 00:40:29 np0000001578 kernel: On node 0, zone DMA: 97 pages in unavailable ranges May 28 00:40:29 np0000001578 kernel: On node 0, zone Normal: 37 pages in unavailable ranges May 28 00:40:29 np0000001578 kernel: ACPI: PM-Timer IO Port: 0x608 May 28 00:40:29 np0000001578 kernel: ACPI: LAPIC_NMI (acpi_id[0xff] dfl dfl lint[0x1]) May 28 00:40:29 np0000001578 kernel: IOAPIC[0]: apic_id 0, version 17, address 0xfec00000, GSI 0-23 May 28 00:40:29 np0000001578 kernel: ACPI: INT_SRC_OVR (bus 0 bus_irq 0 global_irq 2 dfl dfl) May 28 00:40:29 np0000001578 kernel: ACPI: INT_SRC_OVR (bus 0 bus_irq 5 global_irq 5 high level) May 28 00:40:29 np0000001578 kernel: ACPI: INT_SRC_OVR (bus 0 bus_irq 9 global_irq 9 high level) May 28 00:40:29 np0000001578 kernel: ACPI: INT_SRC_OVR (bus 0 bus_irq 10 global_irq 10 high level) May 28 00:40:29 np0000001578 kernel: ACPI: INT_SRC_OVR (bus 0 bus_irq 11 global_irq 11 high level) May 28 00:40:29 np0000001578 kernel: ACPI: Using ACPI (MADT) for SMP configuration information May 28 00:40:29 np0000001578 kernel: TSC deadline timer available May 28 00:40:29 np0000001578 kernel: smpboot: Allowing 12 CPUs, 0 hotplug CPUs May 28 00:40:29 np0000001578 kernel: kvm-guest: APIC: eoi() replaced with kvm_guest_apic_eoi_write() May 28 00:40:29 np0000001578 kernel: PM: hibernation: Registered nosave memory: [mem 0x00000000-0x00000fff] May 28 00:40:29 np0000001578 kernel: PM: hibernation: Registered nosave memory: [mem 0x0009f000-0x000fffff] May 28 00:40:29 np0000001578 kernel: PM: hibernation: Registered nosave memory: [mem 0x7ffdb000-0xffffffff] May 28 00:40:29 np0000001578 kernel: [mem 0xc0000000-0xfed1bfff] available for PCI devices May 28 00:40:29 np0000001578 kernel: Booting paravirtualized kernel on KVM May 28 00:40:29 np0000001578 kernel: clocksource: refined-jiffies: mask: 0xffffffff max_cycles: 0xffffffff, max_idle_ns: 1910969940391419 ns May 28 00:40:29 np0000001578 kernel: setup_percpu: NR_CPUS:8192 nr_cpumask_bits:12 nr_cpu_ids:12 nr_node_ids:1 May 28 00:40:29 np0000001578 kernel: percpu: Embedded 86 pages/cpu s229376 r8192 d114688 u524288 May 28 00:40:29 np0000001578 kernel: pcpu-alloc: s229376 r8192 d114688 u524288 alloc=1*2097152 May 28 00:40:29 np0000001578 kernel: pcpu-alloc: [0] 00 01 02 03 [0] 04 05 06 07 May 28 00:40:29 np0000001578 kernel: pcpu-alloc: [0] 08 09 10 11 May 28 00:40:29 np0000001578 kernel: kvm-guest: PV spinlocks disabled, no host support May 28 00:40:29 np0000001578 kernel: Kernel command line: BOOT_IMAGE=/vmlinuz-6.8.0-117-generic root=UUID=8515de1c-ba7e-467b-adde-6d9f8a8dbc1f ro amd_pstate=guided video=vesafb:off nomodeset i915.modeset=0 libata.fua=1 swapaccount=1 usbcore.autosuspend=-1 vga=normal systemd.unified_cgroup_hierarchy=0 nofb systemd.legacy_systemd_cgroup_controller=1 console=tty1 console=ttyS0 crashkernel=1024M May 28 00:40:29 np0000001578 kernel: Booted with the nomodeset parameter. Only the system framebuffer will be available May 28 00:40:29 np0000001578 kernel: Unknown kernel command line parameters "nofb vga=normal", will be passed to user space. May 28 00:40:29 np0000001578 kernel: random: crng init done May 28 00:40:29 np0000001578 kernel: Dentry cache hash table entries: 4194304 (order: 13, 33554432 bytes, linear) May 28 00:40:29 np0000001578 kernel: Inode-cache hash table entries: 2097152 (order: 12, 16777216 bytes, linear) May 28 00:40:29 np0000001578 kernel: Fallback order for Node 0: 0 May 28 00:40:29 np0000001578 kernel: Built 1 zonelists, mobility grouping on. Total pages: 6192859 May 28 00:40:29 np0000001578 kernel: Policy zone: Normal May 28 00:40:29 np0000001578 kernel: mem auto-init: stack:all(zero), heap alloc:on, heap free:off May 28 00:40:29 np0000001578 kernel: software IO TLB: area num 16. May 28 00:40:29 np0000001578 kernel: Memory: 23519044K/25165284K available (22528K kernel code, 4438K rwdata, 14416K rodata, 4924K init, 4788K bss, 1645980K reserved, 0K cma-reserved) May 28 00:40:29 np0000001578 kernel: SLUB: HWalign=64, Order=0-3, MinObjects=0, CPUs=12, Nodes=1 May 28 00:40:29 np0000001578 kernel: ftrace: allocating 58286 entries in 228 pages May 28 00:40:29 np0000001578 kernel: ftrace: allocated 228 pages with 4 groups May 28 00:40:29 np0000001578 kernel: Dynamic Preempt: voluntary May 28 00:40:29 np0000001578 kernel: rcu: Preemptible hierarchical RCU implementation. May 28 00:40:29 np0000001578 kernel: rcu: RCU restricting CPUs from NR_CPUS=8192 to nr_cpu_ids=12. May 28 00:40:29 np0000001578 kernel: Trampoline variant of Tasks RCU enabled. May 28 00:40:29 np0000001578 kernel: Rude variant of Tasks RCU enabled. May 28 00:40:29 np0000001578 kernel: Tracing variant of Tasks RCU enabled. May 28 00:40:29 np0000001578 kernel: rcu: RCU calculated value of scheduler-enlistment delay is 100 jiffies. May 28 00:40:29 np0000001578 kernel: rcu: Adjusting geometry for rcu_fanout_leaf=16, nr_cpu_ids=12 May 28 00:40:29 np0000001578 kernel: RCU Tasks: Setting shift to 4 and lim to 1 rcu_task_cb_adjust=1 rcu_task_cpu_ids=12. May 28 00:40:29 np0000001578 kernel: RCU Tasks Rude: Setting shift to 4 and lim to 1 rcu_task_cb_adjust=1 rcu_task_cpu_ids=12. May 28 00:40:29 np0000001578 kernel: RCU Tasks Trace: Setting shift to 4 and lim to 1 rcu_task_cb_adjust=1 rcu_task_cpu_ids=12. May 28 00:40:29 np0000001578 kernel: NR_IRQS: 524544, nr_irqs: 520, preallocated irqs: 16 May 28 00:40:29 np0000001578 kernel: rcu: srcu_init: Setting srcu_struct sizes based on contention. May 28 00:40:29 np0000001578 kernel: Console: colour VGA+ 80x25 May 28 00:40:29 np0000001578 kernel: printk: legacy console [tty1] enabled May 28 00:40:29 np0000001578 kernel: printk: legacy console [ttyS0] enabled May 28 00:40:29 np0000001578 kernel: ACPI: Core revision 20230628 May 28 00:40:29 np0000001578 kernel: APIC: Switch to symmetric I/O mode setup May 28 00:40:29 np0000001578 kernel: x2apic enabled May 28 00:40:29 np0000001578 kernel: APIC: Switched APIC routing to: physical x2apic May 28 00:40:29 np0000001578 kernel: tsc: Marking TSC unstable due to TSCs unsynchronized May 28 00:40:29 np0000001578 kernel: Calibrating delay loop (skipped) preset value.. 4790.99 BogoMIPS (lpj=2395498) May 28 00:40:29 np0000001578 kernel: x86/cpu: User Mode Instruction Prevention (UMIP) activated May 28 00:40:29 np0000001578 kernel: Last level iTLB entries: 4KB 512, 2MB 255, 4MB 127 May 28 00:40:29 np0000001578 kernel: Last level dTLB entries: 4KB 512, 2MB 255, 4MB 127, 1GB 0 May 28 00:40:29 np0000001578 kernel: Spectre V1 : Mitigation: usercopy/swapgs barriers and __user pointer sanitization May 28 00:40:29 np0000001578 kernel: Spectre V2 : Mitigation: Retpolines May 28 00:40:29 np0000001578 kernel: Spectre V2 : Spectre v2 / SpectreRSB: Filling RSB on context switch and VMEXIT May 28 00:40:29 np0000001578 kernel: Spectre V2 : Enabling Restricted Speculation for firmware calls May 28 00:40:29 np0000001578 kernel: Spectre V2 : mitigation: Enabling conditional Indirect Branch Prediction Barrier May 28 00:40:29 np0000001578 kernel: Speculative Store Bypass: Mitigation: Speculative Store Bypass disabled via prctl May 28 00:40:29 np0000001578 kernel: Speculative Return Stack Overflow: IBPB-extending microcode not applied! May 28 00:40:29 np0000001578 kernel: Speculative Return Stack Overflow: WARNING: See https://kernel.org/doc/html/latest/admin-guide/hw-vuln/srso.html for mitigation options. May 28 00:40:29 np0000001578 kernel: active return thunk: srso_alias_return_thunk May 28 00:40:29 np0000001578 kernel: Speculative Return Stack Overflow: Vulnerable: Safe RET, no microcode May 28 00:40:29 np0000001578 kernel: Transient Scheduler Attacks: Forcing mitigation on in a VM May 28 00:40:29 np0000001578 kernel: Transient Scheduler Attacks: Vulnerable: Clear CPU buffers attempted, no microcode May 28 00:40:29 np0000001578 kernel: x86/fpu: Supporting XSAVE feature 0x001: 'x87 floating point registers' May 28 00:40:29 np0000001578 kernel: x86/fpu: Supporting XSAVE feature 0x002: 'SSE registers' May 28 00:40:29 np0000001578 kernel: x86/fpu: Supporting XSAVE feature 0x004: 'AVX registers' May 28 00:40:29 np0000001578 kernel: x86/fpu: Supporting XSAVE feature 0x200: 'Protection Keys User registers' May 28 00:40:29 np0000001578 kernel: x86/fpu: xstate_offset[2]: 576, xstate_sizes[2]: 256 May 28 00:40:29 np0000001578 kernel: x86/fpu: xstate_offset[9]: 832, xstate_sizes[9]: 8 May 28 00:40:29 np0000001578 kernel: x86/fpu: Enabled xstate features 0x207, context size is 840 bytes, using 'compacted' format. May 28 00:40:29 np0000001578 kernel: Freeing SMP alternatives memory: 48K May 28 00:40:29 np0000001578 kernel: pid_max: default: 32768 minimum: 301 May 28 00:40:29 np0000001578 kernel: LSM: initializing lsm=lockdown,capability,landlock,yama,apparmor,integrity May 28 00:40:29 np0000001578 kernel: landlock: Up and running. May 28 00:40:29 np0000001578 kernel: Yama: becoming mindful. May 28 00:40:29 np0000001578 kernel: AppArmor: AppArmor initialized May 28 00:40:29 np0000001578 kernel: Mount-cache hash table entries: 65536 (order: 7, 524288 bytes, linear) May 28 00:40:29 np0000001578 kernel: Mountpoint-cache hash table entries: 65536 (order: 7, 524288 bytes, linear) May 28 00:40:29 np0000001578 kernel: smpboot: CPU0: AMD EPYC-Milan Processor (family: 0x19, model: 0x1, stepping: 0x1) May 28 00:40:29 np0000001578 kernel: Performance Events: Fam17h+ core perfctr, AMD PMU driver. May 28 00:40:29 np0000001578 kernel: ... version: 0 May 28 00:40:29 np0000001578 kernel: ... bit width: 48 May 28 00:40:29 np0000001578 kernel: ... generic registers: 6 May 28 00:40:29 np0000001578 kernel: ... value mask: 0000ffffffffffff May 28 00:40:29 np0000001578 kernel: ... max period: 00007fffffffffff May 28 00:40:29 np0000001578 kernel: ... fixed-purpose events: 0 May 28 00:40:29 np0000001578 kernel: ... event mask: 000000000000003f May 28 00:40:29 np0000001578 kernel: signal: max sigframe size: 3376 May 28 00:40:29 np0000001578 kernel: rcu: Hierarchical SRCU implementation. May 28 00:40:29 np0000001578 kernel: rcu: Max phase no-delay instances is 400. May 28 00:40:29 np0000001578 kernel: smp: Bringing up secondary CPUs ... May 28 00:40:29 np0000001578 kernel: smpboot: x86: Booting SMP configuration: May 28 00:40:29 np0000001578 kernel: .... node #0, CPUs: #1 #2 #3 #4 #5 #6 #7 #8 #9 #10 #11 May 28 00:40:29 np0000001578 kernel: smp: Brought up 1 node, 12 CPUs May 28 00:40:29 np0000001578 kernel: smpboot: Max logical packages: 12 May 28 00:40:29 np0000001578 kernel: smpboot: Total of 12 processors activated (57491.95 BogoMIPS) May 28 00:40:29 np0000001578 kernel: devtmpfs: initialized May 28 00:40:29 np0000001578 kernel: x86/mm: Memory block size: 128MB May 28 00:40:29 np0000001578 kernel: clocksource: jiffies: mask: 0xffffffff max_cycles: 0xffffffff, max_idle_ns: 1911260446275000 ns May 28 00:40:29 np0000001578 kernel: futex hash table entries: 4096 (order: 6, 262144 bytes, linear) May 28 00:40:29 np0000001578 kernel: pinctrl core: initialized pinctrl subsystem May 28 00:40:29 np0000001578 kernel: PM: RTC time: 00:40:26, date: 2026-05-28 May 28 00:40:29 np0000001578 kernel: NET: Registered PF_NETLINK/PF_ROUTE protocol family May 28 00:40:29 np0000001578 kernel: DMA: preallocated 4096 KiB GFP_KERNEL pool for atomic allocations May 28 00:40:29 np0000001578 kernel: DMA: preallocated 4096 KiB GFP_KERNEL|GFP_DMA pool for atomic allocations May 28 00:40:29 np0000001578 kernel: DMA: preallocated 4096 KiB GFP_KERNEL|GFP_DMA32 pool for atomic allocations May 28 00:40:29 np0000001578 kernel: audit: initializing netlink subsys (disabled) May 28 00:40:29 np0000001578 kernel: audit: type=2000 audit(1779928826.739:1): state=initialized audit_enabled=0 res=1 May 28 00:40:29 np0000001578 kernel: thermal_sys: Registered thermal governor 'fair_share' May 28 00:40:29 np0000001578 kernel: thermal_sys: Registered thermal governor 'bang_bang' May 28 00:40:29 np0000001578 kernel: thermal_sys: Registered thermal governor 'step_wise' May 28 00:40:29 np0000001578 kernel: thermal_sys: Registered thermal governor 'user_space' May 28 00:40:29 np0000001578 kernel: thermal_sys: Registered thermal governor 'power_allocator' May 28 00:40:29 np0000001578 kernel: cpuidle: using governor ladder May 28 00:40:29 np0000001578 kernel: cpuidle: using governor menu May 28 00:40:29 np0000001578 kernel: acpiphp: ACPI Hot Plug PCI Controller Driver version: 0.5 May 28 00:40:29 np0000001578 kernel: PCI: ECAM [mem 0xb0000000-0xbfffffff] (base 0xb0000000) for domain 0000 [bus 00-ff] May 28 00:40:29 np0000001578 kernel: PCI: ECAM [mem 0xb0000000-0xbfffffff] reserved as E820 entry May 28 00:40:29 np0000001578 kernel: PCI: Using configuration type 1 for base access May 28 00:40:29 np0000001578 kernel: kprobes: kprobe jump-optimization is enabled. All kprobes are optimized if possible. May 28 00:40:29 np0000001578 kernel: HugeTLB: registered 1.00 GiB page size, pre-allocated 0 pages May 28 00:40:29 np0000001578 kernel: HugeTLB: 16380 KiB vmemmap can be freed for a 1.00 GiB page May 28 00:40:29 np0000001578 kernel: HugeTLB: registered 2.00 MiB page size, pre-allocated 0 pages May 28 00:40:29 np0000001578 kernel: HugeTLB: 28 KiB vmemmap can be freed for a 2.00 MiB page May 28 00:40:29 np0000001578 kernel: ACPI: Added _OSI(Module Device) May 28 00:40:29 np0000001578 kernel: ACPI: Added _OSI(Processor Device) May 28 00:40:29 np0000001578 kernel: ACPI: Added _OSI(Processor Aggregator Device) May 28 00:40:29 np0000001578 kernel: ACPI: 1 ACPI AML tables successfully acquired and loaded May 28 00:40:29 np0000001578 kernel: ACPI: _OSC evaluation for CPUs failed, trying _PDC May 28 00:40:29 np0000001578 kernel: ACPI: Interpreter enabled May 28 00:40:29 np0000001578 kernel: ACPI: PM: (supports S0 S3 S4 S5) May 28 00:40:29 np0000001578 kernel: ACPI: Using IOAPIC for interrupt routing May 28 00:40:29 np0000001578 kernel: PCI: Using host bridge windows from ACPI; if necessary, use "pci=nocrs" and report a bug May 28 00:40:29 np0000001578 kernel: PCI: Using E820 reservations for host bridge windows May 28 00:40:29 np0000001578 kernel: ACPI: Enabled 2 GPEs in block 00 to 3F May 28 00:40:29 np0000001578 kernel: ACPI: PCI Root Bridge [PCI0] (domain 0000 [bus 00-ff]) May 28 00:40:29 np0000001578 kernel: acpi PNP0A08:00: _OSC: OS supports [ExtendedConfig ASPM ClockPM Segments MSI EDR HPX-Type3] May 28 00:40:29 np0000001578 kernel: acpi PNP0A08:00: _OSC: platform does not support [PCIeHotplug LTR DPC] May 28 00:40:29 np0000001578 kernel: acpi PNP0A08:00: _OSC: OS now controls [SHPCHotplug PME AER PCIeCapability] May 28 00:40:29 np0000001578 kernel: PCI host bridge to bus 0000:00 May 28 00:40:29 np0000001578 kernel: pci_bus 0000:00: root bus resource [io 0x0000-0x0cf7 window] May 28 00:40:29 np0000001578 kernel: pci_bus 0000:00: root bus resource [io 0x0d00-0xffff window] May 28 00:40:29 np0000001578 kernel: pci_bus 0000:00: root bus resource [mem 0x000a0000-0x000bffff window] May 28 00:40:29 np0000001578 kernel: pci_bus 0000:00: root bus resource [mem 0x80000000-0xafffffff window] May 28 00:40:29 np0000001578 kernel: pci_bus 0000:00: root bus resource [mem 0xc0000000-0xfebfffff window] May 28 00:40:29 np0000001578 kernel: pci_bus 0000:00: root bus resource [mem 0xc000000000-0xc7ffffffff window] May 28 00:40:29 np0000001578 kernel: pci_bus 0000:00: root bus resource [bus 00-ff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:00.0: [8086:29c0] type 00 class 0x060000 conventional PCI endpoint May 28 00:40:29 np0000001578 kernel: pci 0000:00:01.0: [1af4:1050] type 00 class 0x030000 conventional PCI endpoint May 28 00:40:29 np0000001578 kernel: pci 0000:00:01.0: BAR 0 [mem 0xfb800000-0xfbffffff pref] May 28 00:40:29 np0000001578 kernel: pci 0000:00:01.0: BAR 2 [mem 0xc220000000-0xc220003fff 64bit pref] May 28 00:40:29 np0000001578 kernel: pci 0000:00:01.0: BAR 4 [mem 0xfea10000-0xfea10fff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:01.0: ROM [mem 0xfea00000-0xfea0ffff pref] May 28 00:40:29 np0000001578 kernel: pci 0000:00:01.0: Video device with shadowed ROM at [mem 0x000c0000-0x000dffff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.0: [1b36:000c] type 01 class 0x060400 PCIe Root Port May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.0: BAR 0 [mem 0xfea11000-0xfea11fff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.0: PCI bridge to [bus 01-02] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.0: bridge window [io 0xc000-0xcfff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.0: bridge window [mem 0xfc600000-0xfc9fffff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.0: bridge window [mem 0xc200000000-0xc21fffffff 64bit pref] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.1: [1b36:000c] type 01 class 0x060400 PCIe Root Port May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.1: BAR 0 [mem 0xfea12000-0xfea12fff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.1: PCI bridge to [bus 03] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.1: bridge window [mem 0xfe800000-0xfe9fffff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.1: bridge window [mem 0xc1e0000000-0xc1ffffffff 64bit pref] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.2: [1b36:000c] type 01 class 0x060400 PCIe Root Port May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.2: BAR 0 [mem 0xfea13000-0xfea13fff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.2: PCI bridge to [bus 04] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.2: bridge window [mem 0xfe600000-0xfe7fffff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.2: bridge window [mem 0xc1c0000000-0xc1dfffffff 64bit pref] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.3: [1b36:000c] type 01 class 0x060400 PCIe Root Port May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.3: BAR 0 [mem 0xfea14000-0xfea14fff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.3: PCI bridge to [bus 05] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.3: bridge window [mem 0xfe400000-0xfe5fffff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.3: bridge window [mem 0xc1a0000000-0xc1bfffffff 64bit pref] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.4: [1b36:000c] type 01 class 0x060400 PCIe Root Port May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.4: BAR 0 [mem 0xfea15000-0xfea15fff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.4: PCI bridge to [bus 06] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.4: bridge window [mem 0xfe200000-0xfe3fffff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.4: bridge window [mem 0xc180000000-0xc19fffffff 64bit pref] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.5: [1b36:000c] type 01 class 0x060400 PCIe Root Port May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.5: BAR 0 [mem 0xfea16000-0xfea16fff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.5: PCI bridge to [bus 07] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.5: bridge window [mem 0xfe000000-0xfe1fffff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.5: bridge window [mem 0xc160000000-0xc17fffffff 64bit pref] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.6: [1b36:000c] type 01 class 0x060400 PCIe Root Port May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.6: BAR 0 [mem 0xfea17000-0xfea17fff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.6: PCI bridge to [bus 08] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.6: bridge window [mem 0xfde00000-0xfdffffff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.6: bridge window [mem 0xc140000000-0xc15fffffff 64bit pref] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.7: [1b36:000c] type 01 class 0x060400 PCIe Root Port May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.7: BAR 0 [mem 0xfea18000-0xfea18fff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.7: PCI bridge to [bus 09] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.7: bridge window [mem 0xfdc00000-0xfddfffff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.7: bridge window [mem 0xc120000000-0xc13fffffff 64bit pref] May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.0: [1b36:000c] type 01 class 0x060400 PCIe Root Port May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.0: BAR 0 [mem 0xfea19000-0xfea19fff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.0: PCI bridge to [bus 0a] May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.0: bridge window [mem 0xfda00000-0xfdbfffff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.0: bridge window [mem 0xc100000000-0xc11fffffff 64bit pref] May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.1: [1b36:000c] type 01 class 0x060400 PCIe Root Port May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.1: BAR 0 [mem 0xfea1a000-0xfea1afff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.1: PCI bridge to [bus 0b] May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.1: bridge window [mem 0xfd800000-0xfd9fffff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.1: bridge window [mem 0xc0e0000000-0xc0ffffffff 64bit pref] May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.2: [1b36:000c] type 01 class 0x060400 PCIe Root Port May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.2: BAR 0 [mem 0xfea1b000-0xfea1bfff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.2: PCI bridge to [bus 0c] May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.2: bridge window [mem 0xfd600000-0xfd7fffff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.2: bridge window [mem 0xc0c0000000-0xc0dfffffff 64bit pref] May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.3: [1b36:000c] type 01 class 0x060400 PCIe Root Port May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.3: BAR 0 [mem 0xfea1c000-0xfea1cfff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.3: PCI bridge to [bus 0d] May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.3: bridge window [mem 0xfd400000-0xfd5fffff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.3: bridge window [mem 0xc0a0000000-0xc0bfffffff 64bit pref] May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.4: [1b36:000c] type 01 class 0x060400 PCIe Root Port May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.4: BAR 0 [mem 0xfea1d000-0xfea1dfff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.4: PCI bridge to [bus 0e] May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.4: bridge window [mem 0xfd200000-0xfd3fffff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.4: bridge window [mem 0xc080000000-0xc09fffffff 64bit pref] May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.5: [1b36:000c] type 01 class 0x060400 PCIe Root Port May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.5: BAR 0 [mem 0xfea1e000-0xfea1efff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.5: PCI bridge to [bus 0f] May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.5: bridge window [mem 0xfd000000-0xfd1fffff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.5: bridge window [mem 0xc060000000-0xc07fffffff 64bit pref] May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.6: [1b36:000c] type 01 class 0x060400 PCIe Root Port May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.6: BAR 0 [mem 0xfea1f000-0xfea1ffff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.6: PCI bridge to [bus 10] May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.6: bridge window [mem 0xfce00000-0xfcffffff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.6: bridge window [mem 0xc040000000-0xc05fffffff 64bit pref] May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.7: [1b36:000c] type 01 class 0x060400 PCIe Root Port May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.7: BAR 0 [mem 0xfea20000-0xfea20fff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.7: PCI bridge to [bus 11] May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.7: bridge window [mem 0xfcc00000-0xfcdfffff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.7: bridge window [mem 0xc020000000-0xc03fffffff 64bit pref] May 28 00:40:29 np0000001578 kernel: pci 0000:00:04.0: [1b36:000c] type 01 class 0x060400 PCIe Root Port May 28 00:40:29 np0000001578 kernel: pci 0000:00:04.0: BAR 0 [mem 0xfea21000-0xfea21fff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:04.0: PCI bridge to [bus 12] May 28 00:40:29 np0000001578 kernel: pci 0000:00:04.0: bridge window [mem 0xfca00000-0xfcbfffff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:04.0: bridge window [mem 0xc000000000-0xc01fffffff 64bit pref] May 28 00:40:29 np0000001578 kernel: pci 0000:00:1f.0: [8086:2918] type 00 class 0x060100 conventional PCI endpoint May 28 00:40:29 np0000001578 kernel: pci 0000:00:1f.0: quirk: [io 0x0600-0x067f] claimed by ICH6 ACPI/GPIO/TCO May 28 00:40:29 np0000001578 kernel: pci 0000:00:1f.2: [8086:2922] type 00 class 0x010601 conventional PCI endpoint May 28 00:40:29 np0000001578 kernel: pci 0000:00:1f.2: BAR 4 [io 0xd040-0xd05f] May 28 00:40:29 np0000001578 kernel: pci 0000:00:1f.2: BAR 5 [mem 0xfea22000-0xfea22fff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:1f.3: [8086:2930] type 00 class 0x0c0500 conventional PCI endpoint May 28 00:40:29 np0000001578 kernel: pci 0000:00:1f.3: BAR 4 [io 0x0700-0x073f] May 28 00:40:29 np0000001578 kernel: pci 0000:01:00.0: [1b36:000e] type 01 class 0x060400 PCIe to PCI/PCI-X bridge May 28 00:40:29 np0000001578 kernel: pci 0000:01:00.0: BAR 0 [mem 0xfc800000-0xfc8000ff 64bit] May 28 00:40:29 np0000001578 kernel: pci 0000:01:00.0: PCI bridge to [bus 02] May 28 00:40:29 np0000001578 kernel: pci 0000:01:00.0: bridge window [io 0xc000-0xcfff] May 28 00:40:29 np0000001578 kernel: pci 0000:01:00.0: bridge window [mem 0xfc600000-0xfc7fffff] May 28 00:40:29 np0000001578 kernel: pci 0000:01:00.0: bridge window [mem 0xc200000000-0xc21fffffff 64bit pref] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.0: PCI bridge to [bus 01-02] May 28 00:40:29 np0000001578 kernel: pci_bus 0000:02: extended config space not accessible May 28 00:40:29 np0000001578 kernel: acpiphp: Slot [1] registered May 28 00:40:29 np0000001578 kernel: acpiphp: Slot [0] registered May 28 00:40:29 np0000001578 kernel: acpiphp: Slot [2] registered May 28 00:40:29 np0000001578 kernel: acpiphp: Slot [3] registered May 28 00:40:29 np0000001578 kernel: acpiphp: Slot [4] registered May 28 00:40:29 np0000001578 kernel: acpiphp: Slot [5] registered May 28 00:40:29 np0000001578 kernel: acpiphp: Slot [6] registered May 28 00:40:29 np0000001578 kernel: acpiphp: Slot [7] registered May 28 00:40:29 np0000001578 kernel: acpiphp: Slot [8] registered May 28 00:40:29 np0000001578 kernel: acpiphp: Slot [9] registered May 28 00:40:29 np0000001578 kernel: acpiphp: Slot [10] registered May 28 00:40:29 np0000001578 kernel: acpiphp: Slot [11] registered May 28 00:40:29 np0000001578 kernel: acpiphp: Slot [12] registered May 28 00:40:29 np0000001578 kernel: acpiphp: Slot [13] registered May 28 00:40:29 np0000001578 kernel: acpiphp: Slot [14] registered May 28 00:40:29 np0000001578 kernel: acpiphp: Slot [15] registered May 28 00:40:29 np0000001578 kernel: acpiphp: Slot [16] registered May 28 00:40:29 np0000001578 kernel: acpiphp: Slot [17] registered May 28 00:40:29 np0000001578 kernel: acpiphp: Slot [18] registered May 28 00:40:29 np0000001578 kernel: acpiphp: Slot [19] registered May 28 00:40:29 np0000001578 kernel: acpiphp: Slot [20] registered May 28 00:40:29 np0000001578 kernel: acpiphp: Slot [21] registered May 28 00:40:29 np0000001578 kernel: acpiphp: Slot [22] registered May 28 00:40:29 np0000001578 kernel: acpiphp: Slot [23] registered May 28 00:40:29 np0000001578 kernel: acpiphp: Slot [24] registered May 28 00:40:29 np0000001578 kernel: acpiphp: Slot [25] registered May 28 00:40:29 np0000001578 kernel: acpiphp: Slot [26] registered May 28 00:40:29 np0000001578 kernel: acpiphp: Slot [27] registered May 28 00:40:29 np0000001578 kernel: acpiphp: Slot [28] registered May 28 00:40:29 np0000001578 kernel: acpiphp: Slot [29] registered May 28 00:40:29 np0000001578 kernel: acpiphp: Slot [30] registered May 28 00:40:29 np0000001578 kernel: acpiphp: Slot [31] registered May 28 00:40:29 np0000001578 kernel: pci 0000:02:01.0: [8086:7020] type 00 class 0x0c0300 conventional PCI endpoint May 28 00:40:29 np0000001578 kernel: pci 0000:02:01.0: BAR 4 [io 0xc000-0xc01f] May 28 00:40:29 np0000001578 kernel: pci 0000:01:00.0: PCI bridge to [bus 02] May 28 00:40:29 np0000001578 kernel: acpiphp: Slot [0-2] registered May 28 00:40:29 np0000001578 kernel: pci 0000:03:00.0: [1af4:1041] type 00 class 0x020000 PCIe Endpoint May 28 00:40:29 np0000001578 kernel: pci 0000:03:00.0: BAR 1 [mem 0xfe880000-0xfe880fff] May 28 00:40:29 np0000001578 kernel: pci 0000:03:00.0: BAR 4 [mem 0xc1e0000000-0xc1e0003fff 64bit pref] May 28 00:40:29 np0000001578 kernel: pci 0000:03:00.0: ROM [mem 0xfe800000-0xfe87ffff pref] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.1: PCI bridge to [bus 03] May 28 00:40:29 np0000001578 kernel: acpiphp: Slot [0-3] registered May 28 00:40:29 np0000001578 kernel: pci 0000:04:00.0: [1af4:1048] type 00 class 0x010000 PCIe Endpoint May 28 00:40:29 np0000001578 kernel: pci 0000:04:00.0: BAR 1 [mem 0xfe600000-0xfe600fff] May 28 00:40:29 np0000001578 kernel: pci 0000:04:00.0: BAR 4 [mem 0xc1c0000000-0xc1c0003fff 64bit pref] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.2: PCI bridge to [bus 04] May 28 00:40:29 np0000001578 kernel: acpiphp: Slot [0-4] registered May 28 00:40:29 np0000001578 kernel: pci 0000:05:00.0: [1af4:1045] type 00 class 0x00ff00 PCIe Endpoint May 28 00:40:29 np0000001578 kernel: pci 0000:05:00.0: BAR 4 [mem 0xc1a0000000-0xc1a0003fff 64bit pref] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.3: PCI bridge to [bus 05] May 28 00:40:29 np0000001578 kernel: acpiphp: Slot [0-5] registered May 28 00:40:29 np0000001578 kernel: pci 0000:06:00.0: [1af4:1044] type 00 class 0x00ff00 PCIe Endpoint May 28 00:40:29 np0000001578 kernel: pci 0000:06:00.0: BAR 1 [mem 0xfe200000-0xfe200fff] May 28 00:40:29 np0000001578 kernel: pci 0000:06:00.0: BAR 4 [mem 0xc180000000-0xc180003fff 64bit pref] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.4: PCI bridge to [bus 06] May 28 00:40:29 np0000001578 kernel: acpiphp: Slot [0-6] registered May 28 00:40:29 np0000001578 kernel: pci 0000:07:00.0: [1af4:1041] type 00 class 0x020000 PCIe Endpoint May 28 00:40:29 np0000001578 kernel: pci 0000:07:00.0: BAR 1 [mem 0xfe080000-0xfe080fff] May 28 00:40:29 np0000001578 kernel: pci 0000:07:00.0: BAR 4 [mem 0xc160000000-0xc160003fff 64bit pref] May 28 00:40:29 np0000001578 kernel: pci 0000:07:00.0: ROM [mem 0xfe000000-0xfe07ffff pref] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.5: PCI bridge to [bus 07] May 28 00:40:29 np0000001578 kernel: acpiphp: Slot [0-7] registered May 28 00:40:29 np0000001578 kernel: pci 0000:08:00.0: [1af4:1041] type 00 class 0x020000 PCIe Endpoint May 28 00:40:29 np0000001578 kernel: pci 0000:08:00.0: BAR 1 [mem 0xfde80000-0xfde80fff] May 28 00:40:29 np0000001578 kernel: pci 0000:08:00.0: BAR 4 [mem 0xc140000000-0xc140003fff 64bit pref] May 28 00:40:29 np0000001578 kernel: pci 0000:08:00.0: ROM [mem 0xfde00000-0xfde7ffff pref] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.6: PCI bridge to [bus 08] May 28 00:40:29 np0000001578 kernel: acpiphp: Slot [0-8] registered May 28 00:40:29 np0000001578 kernel: pci 0000:09:00.0: [1af4:1041] type 00 class 0x020000 PCIe Endpoint May 28 00:40:29 np0000001578 kernel: pci 0000:09:00.0: BAR 1 [mem 0xfdc80000-0xfdc80fff] May 28 00:40:29 np0000001578 kernel: pci 0000:09:00.0: BAR 4 [mem 0xc120000000-0xc120003fff 64bit pref] May 28 00:40:29 np0000001578 kernel: pci 0000:09:00.0: ROM [mem 0xfdc00000-0xfdc7ffff pref] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.7: PCI bridge to [bus 09] May 28 00:40:29 np0000001578 kernel: acpiphp: Slot [0-9] registered May 28 00:40:29 np0000001578 kernel: pci 0000:0a:00.0: [1af4:1041] type 00 class 0x020000 PCIe Endpoint May 28 00:40:29 np0000001578 kernel: pci 0000:0a:00.0: BAR 1 [mem 0xfda80000-0xfda80fff] May 28 00:40:29 np0000001578 kernel: pci 0000:0a:00.0: BAR 4 [mem 0xc100000000-0xc100003fff 64bit pref] May 28 00:40:29 np0000001578 kernel: pci 0000:0a:00.0: ROM [mem 0xfda00000-0xfda7ffff pref] May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.0: PCI bridge to [bus 0a] May 28 00:40:29 np0000001578 kernel: acpiphp: Slot [0-10] registered May 28 00:40:29 np0000001578 kernel: pci 0000:0b:00.0: [1af4:1041] type 00 class 0x020000 PCIe Endpoint May 28 00:40:29 np0000001578 kernel: pci 0000:0b:00.0: BAR 1 [mem 0xfd880000-0xfd880fff] May 28 00:40:29 np0000001578 kernel: pci 0000:0b:00.0: BAR 4 [mem 0xc0e0000000-0xc0e0003fff 64bit pref] May 28 00:40:29 np0000001578 kernel: pci 0000:0b:00.0: ROM [mem 0xfd800000-0xfd87ffff pref] May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.1: PCI bridge to [bus 0b] May 28 00:40:29 np0000001578 kernel: acpiphp: Slot [0-11] registered May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.2: PCI bridge to [bus 0c] May 28 00:40:29 np0000001578 kernel: acpiphp: Slot [0-12] registered May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.3: PCI bridge to [bus 0d] May 28 00:40:29 np0000001578 kernel: acpiphp: Slot [0-13] registered May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.4: PCI bridge to [bus 0e] May 28 00:40:29 np0000001578 kernel: acpiphp: Slot [0-14] registered May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.5: PCI bridge to [bus 0f] May 28 00:40:29 np0000001578 kernel: acpiphp: Slot [0-15] registered May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.6: PCI bridge to [bus 10] May 28 00:40:29 np0000001578 kernel: acpiphp: Slot [0-16] registered May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.7: PCI bridge to [bus 11] May 28 00:40:29 np0000001578 kernel: acpiphp: Slot [0-17] registered May 28 00:40:29 np0000001578 kernel: pci 0000:00:04.0: PCI bridge to [bus 12] May 28 00:40:29 np0000001578 kernel: ACPI: PCI: Interrupt link LNKA configured for IRQ 10 May 28 00:40:29 np0000001578 kernel: ACPI: PCI: Interrupt link LNKB configured for IRQ 10 May 28 00:40:29 np0000001578 kernel: ACPI: PCI: Interrupt link LNKC configured for IRQ 11 May 28 00:40:29 np0000001578 kernel: ACPI: PCI: Interrupt link LNKD configured for IRQ 11 May 28 00:40:29 np0000001578 kernel: ACPI: PCI: Interrupt link LNKE configured for IRQ 10 May 28 00:40:29 np0000001578 kernel: ACPI: PCI: Interrupt link LNKF configured for IRQ 10 May 28 00:40:29 np0000001578 kernel: ACPI: PCI: Interrupt link LNKG configured for IRQ 11 May 28 00:40:29 np0000001578 kernel: ACPI: PCI: Interrupt link LNKH configured for IRQ 11 May 28 00:40:29 np0000001578 kernel: ACPI: PCI: Interrupt link GSIA configured for IRQ 16 May 28 00:40:29 np0000001578 kernel: ACPI: PCI: Interrupt link GSIB configured for IRQ 17 May 28 00:40:29 np0000001578 kernel: ACPI: PCI: Interrupt link GSIC configured for IRQ 18 May 28 00:40:29 np0000001578 kernel: ACPI: PCI: Interrupt link GSID configured for IRQ 19 May 28 00:40:29 np0000001578 kernel: ACPI: PCI: Interrupt link GSIE configured for IRQ 20 May 28 00:40:29 np0000001578 kernel: ACPI: PCI: Interrupt link GSIF configured for IRQ 21 May 28 00:40:29 np0000001578 kernel: ACPI: PCI: Interrupt link GSIG configured for IRQ 22 May 28 00:40:29 np0000001578 kernel: ACPI: PCI: Interrupt link GSIH configured for IRQ 23 May 28 00:40:29 np0000001578 kernel: iommu: Default domain type: Translated May 28 00:40:29 np0000001578 kernel: iommu: DMA domain TLB invalidation policy: lazy mode May 28 00:40:29 np0000001578 kernel: SCSI subsystem initialized May 28 00:40:29 np0000001578 kernel: libata version 3.00 loaded. May 28 00:40:29 np0000001578 kernel: ACPI: bus type USB registered May 28 00:40:29 np0000001578 kernel: usbcore: registered new interface driver usbfs May 28 00:40:29 np0000001578 kernel: usbcore: registered new interface driver hub May 28 00:40:29 np0000001578 kernel: usbcore: registered new device driver usb May 28 00:40:29 np0000001578 kernel: pps_core: LinuxPPS API ver. 1 registered May 28 00:40:29 np0000001578 kernel: pps_core: Software ver. 5.3.6 - Copyright 2005-2007 Rodolfo Giometti May 28 00:40:29 np0000001578 kernel: PTP clock support registered May 28 00:40:29 np0000001578 kernel: EDAC MC: Ver: 3.0.0 May 28 00:40:29 np0000001578 kernel: NetLabel: Initializing May 28 00:40:29 np0000001578 kernel: NetLabel: domain hash size = 128 May 28 00:40:29 np0000001578 kernel: NetLabel: protocols = UNLABELED CIPSOv4 CALIPSO May 28 00:40:29 np0000001578 kernel: NetLabel: unlabeled traffic allowed by default May 28 00:40:29 np0000001578 kernel: mctp: management component transport protocol core May 28 00:40:29 np0000001578 kernel: NET: Registered PF_MCTP protocol family May 28 00:40:29 np0000001578 kernel: PCI: Using ACPI for IRQ routing May 28 00:40:29 np0000001578 kernel: PCI: pci_cache_line_size set to 64 bytes May 28 00:40:29 np0000001578 kernel: e820: reserve RAM buffer [mem 0x0009fc00-0x0009ffff] May 28 00:40:29 np0000001578 kernel: e820: reserve RAM buffer [mem 0x7ffdb000-0x7fffffff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:01.0: vgaarb: setting as boot VGA device May 28 00:40:29 np0000001578 kernel: pci 0000:00:01.0: vgaarb: bridge control possible May 28 00:40:29 np0000001578 kernel: pci 0000:00:01.0: vgaarb: VGA device added: decodes=io+mem,owns=io+mem,locks=none May 28 00:40:29 np0000001578 kernel: vgaarb: loaded May 28 00:40:29 np0000001578 kernel: clocksource: Switched to clocksource kvm-clock May 28 00:40:29 np0000001578 kernel: VFS: Disk quotas dquot_6.6.0 May 28 00:40:29 np0000001578 kernel: VFS: Dquot-cache hash table entries: 512 (order 0, 4096 bytes) May 28 00:40:29 np0000001578 kernel: AppArmor: AppArmor Filesystem Enabled May 28 00:40:29 np0000001578 kernel: pnp: PnP ACPI init May 28 00:40:29 np0000001578 kernel: system 00:04: [mem 0xb0000000-0xbfffffff window] has been reserved May 28 00:40:29 np0000001578 kernel: pnp: PnP ACPI: found 5 devices May 28 00:40:29 np0000001578 kernel: clocksource: acpi_pm: mask: 0xffffff max_cycles: 0xffffff, max_idle_ns: 2085701024 ns May 28 00:40:29 np0000001578 kernel: NET: Registered PF_INET protocol family May 28 00:40:29 np0000001578 kernel: IP idents hash table entries: 262144 (order: 9, 2097152 bytes, linear) May 28 00:40:29 np0000001578 kernel: tcp_listen_portaddr_hash hash table entries: 16384 (order: 6, 262144 bytes, linear) May 28 00:40:29 np0000001578 kernel: Table-perturb hash table entries: 65536 (order: 6, 262144 bytes, linear) May 28 00:40:29 np0000001578 kernel: TCP established hash table entries: 262144 (order: 9, 2097152 bytes, linear) May 28 00:40:29 np0000001578 kernel: TCP bind hash table entries: 65536 (order: 9, 2097152 bytes, linear) May 28 00:40:29 np0000001578 kernel: TCP: Hash tables configured (established 262144 bind 65536) May 28 00:40:29 np0000001578 kernel: MPTCP token hash table entries: 32768 (order: 8, 786432 bytes, linear) May 28 00:40:29 np0000001578 kernel: UDP hash table entries: 16384 (order: 7, 524288 bytes, linear) May 28 00:40:29 np0000001578 kernel: UDP-Lite hash table entries: 16384 (order: 7, 524288 bytes, linear) May 28 00:40:29 np0000001578 kernel: NET: Registered PF_UNIX/PF_LOCAL protocol family May 28 00:40:29 np0000001578 kernel: NET: Registered PF_XDP protocol family May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.1: bridge window [io 0x1000-0x0fff] to [bus 03] add_size 1000 May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.2: bridge window [io 0x1000-0x0fff] to [bus 04] add_size 1000 May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.3: bridge window [io 0x1000-0x0fff] to [bus 05] add_size 1000 May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.4: bridge window [io 0x1000-0x0fff] to [bus 06] add_size 1000 May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.5: bridge window [io 0x1000-0x0fff] to [bus 07] add_size 1000 May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.6: bridge window [io 0x1000-0x0fff] to [bus 08] add_size 1000 May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.7: bridge window [io 0x1000-0x0fff] to [bus 09] add_size 1000 May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.0: bridge window [io 0x1000-0x0fff] to [bus 0a] add_size 1000 May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.1: bridge window [io 0x1000-0x0fff] to [bus 0b] add_size 1000 May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.2: bridge window [io 0x1000-0x0fff] to [bus 0c] add_size 1000 May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.3: bridge window [io 0x1000-0x0fff] to [bus 0d] add_size 1000 May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.4: bridge window [io 0x1000-0x0fff] to [bus 0e] add_size 1000 May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.5: bridge window [io 0x1000-0x0fff] to [bus 0f] add_size 1000 May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.6: bridge window [io 0x1000-0x0fff] to [bus 10] add_size 1000 May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.7: bridge window [io 0x1000-0x0fff] to [bus 11] add_size 1000 May 28 00:40:29 np0000001578 kernel: pci 0000:00:04.0: bridge window [io 0x1000-0x0fff] to [bus 12] add_size 1000 May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.1: bridge window [io 0x1000-0x1fff]: assigned May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.2: bridge window [io 0x2000-0x2fff]: assigned May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.3: bridge window [io 0x3000-0x3fff]: assigned May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.4: bridge window [io 0x4000-0x4fff]: assigned May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.5: bridge window [io 0x5000-0x5fff]: assigned May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.6: bridge window [io 0x6000-0x6fff]: assigned May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.7: bridge window [io 0x7000-0x7fff]: assigned May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.0: bridge window [io 0x8000-0x8fff]: assigned May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.1: bridge window [io 0x9000-0x9fff]: assigned May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.2: bridge window [io 0xa000-0xafff]: assigned May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.3: bridge window [io 0xb000-0xbfff]: assigned May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.4: bridge window [io 0xe000-0xefff]: assigned May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.5: bridge window [io 0xf000-0xffff]: assigned May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.6: bridge window [io size 0x1000]: can't assign; no space May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.6: bridge window [io size 0x1000]: failed to assign May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.7: bridge window [io size 0x1000]: can't assign; no space May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.7: bridge window [io size 0x1000]: failed to assign May 28 00:40:29 np0000001578 kernel: pci 0000:00:04.0: bridge window [io size 0x1000]: can't assign; no space May 28 00:40:29 np0000001578 kernel: pci 0000:00:04.0: bridge window [io size 0x1000]: failed to assign May 28 00:40:29 np0000001578 kernel: pci 0000:00:04.0: bridge window [io 0x1000-0x1fff]: assigned May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.7: bridge window [io 0x2000-0x2fff]: assigned May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.6: bridge window [io 0x3000-0x3fff]: assigned May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.5: bridge window [io 0x4000-0x4fff]: assigned May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.4: bridge window [io 0x5000-0x5fff]: assigned May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.3: bridge window [io 0x6000-0x6fff]: assigned May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.2: bridge window [io 0x7000-0x7fff]: assigned May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.1: bridge window [io 0x8000-0x8fff]: assigned May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.0: bridge window [io 0x9000-0x9fff]: assigned May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.7: bridge window [io 0xa000-0xafff]: assigned May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.6: bridge window [io 0xb000-0xbfff]: assigned May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.5: bridge window [io 0xe000-0xefff]: assigned May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.4: bridge window [io 0xf000-0xffff]: assigned May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.3: bridge window [io size 0x1000]: can't assign; no space May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.3: bridge window [io size 0x1000]: failed to assign May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.2: bridge window [io size 0x1000]: can't assign; no space May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.2: bridge window [io size 0x1000]: failed to assign May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.1: bridge window [io size 0x1000]: can't assign; no space May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.1: bridge window [io size 0x1000]: failed to assign May 28 00:40:29 np0000001578 kernel: pci 0000:01:00.0: PCI bridge to [bus 02] May 28 00:40:29 np0000001578 kernel: pci 0000:01:00.0: bridge window [io 0xc000-0xcfff] May 28 00:40:29 np0000001578 kernel: pci 0000:01:00.0: bridge window [mem 0xfc600000-0xfc7fffff] May 28 00:40:29 np0000001578 kernel: pci 0000:01:00.0: bridge window [mem 0xc200000000-0xc21fffffff 64bit pref] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.0: PCI bridge to [bus 01-02] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.0: bridge window [io 0xc000-0xcfff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.0: bridge window [mem 0xfc600000-0xfc9fffff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.0: bridge window [mem 0xc200000000-0xc21fffffff 64bit pref] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.1: PCI bridge to [bus 03] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.1: bridge window [mem 0xfe800000-0xfe9fffff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.1: bridge window [mem 0xc1e0000000-0xc1ffffffff 64bit pref] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.2: PCI bridge to [bus 04] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.2: bridge window [mem 0xfe600000-0xfe7fffff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.2: bridge window [mem 0xc1c0000000-0xc1dfffffff 64bit pref] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.3: PCI bridge to [bus 05] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.3: bridge window [mem 0xfe400000-0xfe5fffff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.3: bridge window [mem 0xc1a0000000-0xc1bfffffff 64bit pref] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.4: PCI bridge to [bus 06] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.4: bridge window [io 0xf000-0xffff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.4: bridge window [mem 0xfe200000-0xfe3fffff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.4: bridge window [mem 0xc180000000-0xc19fffffff 64bit pref] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.5: PCI bridge to [bus 07] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.5: bridge window [io 0xe000-0xefff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.5: bridge window [mem 0xfe000000-0xfe1fffff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.5: bridge window [mem 0xc160000000-0xc17fffffff 64bit pref] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.6: PCI bridge to [bus 08] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.6: bridge window [io 0xb000-0xbfff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.6: bridge window [mem 0xfde00000-0xfdffffff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.6: bridge window [mem 0xc140000000-0xc15fffffff 64bit pref] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.7: PCI bridge to [bus 09] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.7: bridge window [io 0xa000-0xafff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.7: bridge window [mem 0xfdc00000-0xfddfffff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:02.7: bridge window [mem 0xc120000000-0xc13fffffff 64bit pref] May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.0: PCI bridge to [bus 0a] May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.0: bridge window [io 0x9000-0x9fff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.0: bridge window [mem 0xfda00000-0xfdbfffff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.0: bridge window [mem 0xc100000000-0xc11fffffff 64bit pref] May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.1: PCI bridge to [bus 0b] May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.1: bridge window [io 0x8000-0x8fff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.1: bridge window [mem 0xfd800000-0xfd9fffff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.1: bridge window [mem 0xc0e0000000-0xc0ffffffff 64bit pref] May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.2: PCI bridge to [bus 0c] May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.2: bridge window [io 0x7000-0x7fff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.2: bridge window [mem 0xfd600000-0xfd7fffff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.2: bridge window [mem 0xc0c0000000-0xc0dfffffff 64bit pref] May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.3: PCI bridge to [bus 0d] May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.3: bridge window [io 0x6000-0x6fff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.3: bridge window [mem 0xfd400000-0xfd5fffff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.3: bridge window [mem 0xc0a0000000-0xc0bfffffff 64bit pref] May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.4: PCI bridge to [bus 0e] May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.4: bridge window [io 0x5000-0x5fff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.4: bridge window [mem 0xfd200000-0xfd3fffff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.4: bridge window [mem 0xc080000000-0xc09fffffff 64bit pref] May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.5: PCI bridge to [bus 0f] May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.5: bridge window [io 0x4000-0x4fff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.5: bridge window [mem 0xfd000000-0xfd1fffff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.5: bridge window [mem 0xc060000000-0xc07fffffff 64bit pref] May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.6: PCI bridge to [bus 10] May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.6: bridge window [io 0x3000-0x3fff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.6: bridge window [mem 0xfce00000-0xfcffffff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.6: bridge window [mem 0xc040000000-0xc05fffffff 64bit pref] May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.7: PCI bridge to [bus 11] May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.7: bridge window [io 0x2000-0x2fff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.7: bridge window [mem 0xfcc00000-0xfcdfffff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:03.7: bridge window [mem 0xc020000000-0xc03fffffff 64bit pref] May 28 00:40:29 np0000001578 kernel: pci 0000:00:04.0: PCI bridge to [bus 12] May 28 00:40:29 np0000001578 kernel: pci 0000:00:04.0: bridge window [io 0x1000-0x1fff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:04.0: bridge window [mem 0xfca00000-0xfcbfffff] May 28 00:40:29 np0000001578 kernel: pci 0000:00:04.0: bridge window [mem 0xc000000000-0xc01fffffff 64bit pref] May 28 00:40:29 np0000001578 kernel: pci_bus 0000:00: resource 4 [io 0x0000-0x0cf7 window] May 28 00:40:29 np0000001578 kernel: pci_bus 0000:00: resource 5 [io 0x0d00-0xffff window] May 28 00:40:29 np0000001578 kernel: pci_bus 0000:00: resource 6 [mem 0x000a0000-0x000bffff window] May 28 00:40:29 np0000001578 kernel: pci_bus 0000:00: resource 7 [mem 0x80000000-0xafffffff window] May 28 00:40:29 np0000001578 kernel: pci_bus 0000:00: resource 8 [mem 0xc0000000-0xfebfffff window] May 28 00:40:29 np0000001578 kernel: pci_bus 0000:00: resource 9 [mem 0xc000000000-0xc7ffffffff window] May 28 00:40:29 np0000001578 kernel: pci_bus 0000:01: resource 0 [io 0xc000-0xcfff] May 28 00:40:29 np0000001578 kernel: pci_bus 0000:01: resource 1 [mem 0xfc600000-0xfc9fffff] May 28 00:40:29 np0000001578 kernel: pci_bus 0000:01: resource 2 [mem 0xc200000000-0xc21fffffff 64bit pref] May 28 00:40:29 np0000001578 kernel: pci_bus 0000:02: resource 0 [io 0xc000-0xcfff] May 28 00:40:29 np0000001578 kernel: pci_bus 0000:02: resource 1 [mem 0xfc600000-0xfc7fffff] May 28 00:40:29 np0000001578 kernel: pci_bus 0000:02: resource 2 [mem 0xc200000000-0xc21fffffff 64bit pref] May 28 00:40:29 np0000001578 kernel: pci_bus 0000:03: resource 1 [mem 0xfe800000-0xfe9fffff] May 28 00:40:29 np0000001578 kernel: pci_bus 0000:03: resource 2 [mem 0xc1e0000000-0xc1ffffffff 64bit pref] May 28 00:40:29 np0000001578 kernel: pci_bus 0000:04: resource 1 [mem 0xfe600000-0xfe7fffff] May 28 00:40:29 np0000001578 kernel: pci_bus 0000:04: resource 2 [mem 0xc1c0000000-0xc1dfffffff 64bit pref] May 28 00:40:29 np0000001578 kernel: pci_bus 0000:05: resource 1 [mem 0xfe400000-0xfe5fffff] May 28 00:40:29 np0000001578 kernel: pci_bus 0000:05: resource 2 [mem 0xc1a0000000-0xc1bfffffff 64bit pref] May 28 00:40:29 np0000001578 kernel: pci_bus 0000:06: resource 0 [io 0xf000-0xffff] May 28 00:40:29 np0000001578 kernel: pci_bus 0000:06: resource 1 [mem 0xfe200000-0xfe3fffff] May 28 00:40:29 np0000001578 kernel: pci_bus 0000:06: resource 2 [mem 0xc180000000-0xc19fffffff 64bit pref] May 28 00:40:29 np0000001578 kernel: pci_bus 0000:07: resource 0 [io 0xe000-0xefff] May 28 00:40:29 np0000001578 kernel: pci_bus 0000:07: resource 1 [mem 0xfe000000-0xfe1fffff] May 28 00:40:29 np0000001578 kernel: pci_bus 0000:07: resource 2 [mem 0xc160000000-0xc17fffffff 64bit pref] May 28 00:40:29 np0000001578 kernel: pci_bus 0000:08: resource 0 [io 0xb000-0xbfff] May 28 00:40:29 np0000001578 kernel: pci_bus 0000:08: resource 1 [mem 0xfde00000-0xfdffffff] May 28 00:40:29 np0000001578 kernel: pci_bus 0000:08: resource 2 [mem 0xc140000000-0xc15fffffff 64bit pref] May 28 00:40:29 np0000001578 kernel: pci_bus 0000:09: resource 0 [io 0xa000-0xafff] May 28 00:40:29 np0000001578 kernel: pci_bus 0000:09: resource 1 [mem 0xfdc00000-0xfddfffff] May 28 00:40:29 np0000001578 kernel: pci_bus 0000:09: resource 2 [mem 0xc120000000-0xc13fffffff 64bit pref] May 28 00:40:29 np0000001578 kernel: pci_bus 0000:0a: resource 0 [io 0x9000-0x9fff] May 28 00:40:29 np0000001578 kernel: pci_bus 0000:0a: resource 1 [mem 0xfda00000-0xfdbfffff] May 28 00:40:29 np0000001578 kernel: pci_bus 0000:0a: resource 2 [mem 0xc100000000-0xc11fffffff 64bit pref] May 28 00:40:29 np0000001578 kernel: pci_bus 0000:0b: resource 0 [io 0x8000-0x8fff] May 28 00:40:29 np0000001578 kernel: pci_bus 0000:0b: resource 1 [mem 0xfd800000-0xfd9fffff] May 28 00:40:29 np0000001578 kernel: pci_bus 0000:0b: resource 2 [mem 0xc0e0000000-0xc0ffffffff 64bit pref] May 28 00:40:29 np0000001578 kernel: pci_bus 0000:0c: resource 0 [io 0x7000-0x7fff] May 28 00:40:29 np0000001578 kernel: pci_bus 0000:0c: resource 1 [mem 0xfd600000-0xfd7fffff] May 28 00:40:29 np0000001578 kernel: pci_bus 0000:0c: resource 2 [mem 0xc0c0000000-0xc0dfffffff 64bit pref] May 28 00:40:29 np0000001578 kernel: pci_bus 0000:0d: resource 0 [io 0x6000-0x6fff] May 28 00:40:29 np0000001578 kernel: pci_bus 0000:0d: resource 1 [mem 0xfd400000-0xfd5fffff] May 28 00:40:29 np0000001578 kernel: pci_bus 0000:0d: resource 2 [mem 0xc0a0000000-0xc0bfffffff 64bit pref] May 28 00:40:29 np0000001578 kernel: pci_bus 0000:0e: resource 0 [io 0x5000-0x5fff] May 28 00:40:29 np0000001578 kernel: pci_bus 0000:0e: resource 1 [mem 0xfd200000-0xfd3fffff] May 28 00:40:29 np0000001578 kernel: pci_bus 0000:0e: resource 2 [mem 0xc080000000-0xc09fffffff 64bit pref] May 28 00:40:29 np0000001578 kernel: pci_bus 0000:0f: resource 0 [io 0x4000-0x4fff] May 28 00:40:29 np0000001578 kernel: pci_bus 0000:0f: resource 1 [mem 0xfd000000-0xfd1fffff] May 28 00:40:29 np0000001578 kernel: pci_bus 0000:0f: resource 2 [mem 0xc060000000-0xc07fffffff 64bit pref] May 28 00:40:29 np0000001578 kernel: pci_bus 0000:10: resource 0 [io 0x3000-0x3fff] May 28 00:40:29 np0000001578 kernel: pci_bus 0000:10: resource 1 [mem 0xfce00000-0xfcffffff] May 28 00:40:29 np0000001578 kernel: pci_bus 0000:10: resource 2 [mem 0xc040000000-0xc05fffffff 64bit pref] May 28 00:40:29 np0000001578 kernel: pci_bus 0000:11: resource 0 [io 0x2000-0x2fff] May 28 00:40:29 np0000001578 kernel: pci_bus 0000:11: resource 1 [mem 0xfcc00000-0xfcdfffff] May 28 00:40:29 np0000001578 kernel: pci_bus 0000:11: resource 2 [mem 0xc020000000-0xc03fffffff 64bit pref] May 28 00:40:29 np0000001578 kernel: pci_bus 0000:12: resource 0 [io 0x1000-0x1fff] May 28 00:40:29 np0000001578 kernel: pci_bus 0000:12: resource 1 [mem 0xfca00000-0xfcbfffff] May 28 00:40:29 np0000001578 kernel: pci_bus 0000:12: resource 2 [mem 0xc000000000-0xc01fffffff 64bit pref] May 28 00:40:29 np0000001578 kernel: ACPI: \_SB_.GSIG: Enabled at IRQ 22 May 28 00:40:29 np0000001578 kernel: PCI: CLS 0 bytes, default 64 May 28 00:40:29 np0000001578 kernel: PCI-DMA: Using software bounce buffering for IO (SWIOTLB) May 28 00:40:29 np0000001578 kernel: software IO TLB: mapped [mem 0x000000003b000000-0x000000003f000000] (64MB) May 28 00:40:29 np0000001578 kernel: Trying to unpack rootfs image as initramfs... May 28 00:40:29 np0000001578 kernel: Initialise system trusted keyrings May 28 00:40:29 np0000001578 kernel: Key type blacklist registered May 28 00:40:29 np0000001578 kernel: workingset: timestamp_bits=36 max_order=23 bucket_order=0 May 28 00:40:29 np0000001578 kernel: zbud: loaded May 28 00:40:29 np0000001578 kernel: squashfs: version 4.0 (2009/01/31) Phillip Lougher May 28 00:40:29 np0000001578 kernel: fuse: init (API version 7.39) May 28 00:40:29 np0000001578 kernel: integrity: Platform Keyring initialized May 28 00:40:29 np0000001578 kernel: integrity: Machine keyring initialized May 28 00:40:29 np0000001578 kernel: Key type asymmetric registered May 28 00:40:29 np0000001578 kernel: Asymmetric key parser 'x509' registered May 28 00:40:29 np0000001578 kernel: Block layer SCSI generic (bsg) driver version 0.4 loaded (major 243) May 28 00:40:29 np0000001578 kernel: io scheduler mq-deadline registered May 28 00:40:29 np0000001578 kernel: pcieport 0000:00:02.0: PME: Signaling with IRQ 24 May 28 00:40:29 np0000001578 kernel: pcieport 0000:00:02.0: AER: enabled with IRQ 24 May 28 00:40:29 np0000001578 kernel: pcieport 0000:00:02.1: PME: Signaling with IRQ 25 May 28 00:40:29 np0000001578 kernel: pcieport 0000:00:02.1: AER: enabled with IRQ 25 May 28 00:40:29 np0000001578 kernel: pcieport 0000:00:02.2: PME: Signaling with IRQ 26 May 28 00:40:29 np0000001578 kernel: pcieport 0000:00:02.2: AER: enabled with IRQ 26 May 28 00:40:29 np0000001578 kernel: pcieport 0000:00:02.3: PME: Signaling with IRQ 27 May 28 00:40:29 np0000001578 kernel: pcieport 0000:00:02.3: AER: enabled with IRQ 27 May 28 00:40:29 np0000001578 kernel: pcieport 0000:00:02.4: PME: Signaling with IRQ 28 May 28 00:40:29 np0000001578 kernel: pcieport 0000:00:02.4: AER: enabled with IRQ 28 May 28 00:40:29 np0000001578 kernel: pcieport 0000:00:02.5: PME: Signaling with IRQ 29 May 28 00:40:29 np0000001578 kernel: pcieport 0000:00:02.5: AER: enabled with IRQ 29 May 28 00:40:29 np0000001578 kernel: pcieport 0000:00:02.6: PME: Signaling with IRQ 30 May 28 00:40:29 np0000001578 kernel: pcieport 0000:00:02.6: AER: enabled with IRQ 30 May 28 00:40:29 np0000001578 kernel: pcieport 0000:00:02.7: PME: Signaling with IRQ 31 May 28 00:40:29 np0000001578 kernel: pcieport 0000:00:02.7: AER: enabled with IRQ 31 May 28 00:40:29 np0000001578 kernel: ACPI: \_SB_.GSIH: Enabled at IRQ 23 May 28 00:40:29 np0000001578 kernel: pcieport 0000:00:03.0: PME: Signaling with IRQ 32 May 28 00:40:29 np0000001578 kernel: pcieport 0000:00:03.0: AER: enabled with IRQ 32 May 28 00:40:29 np0000001578 kernel: pcieport 0000:00:03.1: PME: Signaling with IRQ 33 May 28 00:40:29 np0000001578 kernel: pcieport 0000:00:03.1: AER: enabled with IRQ 33 May 28 00:40:29 np0000001578 kernel: pcieport 0000:00:03.2: PME: Signaling with IRQ 34 May 28 00:40:29 np0000001578 kernel: pcieport 0000:00:03.2: AER: enabled with IRQ 34 May 28 00:40:29 np0000001578 kernel: pcieport 0000:00:03.3: PME: Signaling with IRQ 35 May 28 00:40:29 np0000001578 kernel: pcieport 0000:00:03.3: AER: enabled with IRQ 35 May 28 00:40:29 np0000001578 kernel: pcieport 0000:00:03.4: PME: Signaling with IRQ 36 May 28 00:40:29 np0000001578 kernel: pcieport 0000:00:03.4: AER: enabled with IRQ 36 May 28 00:40:29 np0000001578 kernel: pcieport 0000:00:03.5: PME: Signaling with IRQ 37 May 28 00:40:29 np0000001578 kernel: pcieport 0000:00:03.5: AER: enabled with IRQ 37 May 28 00:40:29 np0000001578 kernel: pcieport 0000:00:03.6: PME: Signaling with IRQ 38 May 28 00:40:29 np0000001578 kernel: pcieport 0000:00:03.6: AER: enabled with IRQ 38 May 28 00:40:29 np0000001578 kernel: pcieport 0000:00:03.7: PME: Signaling with IRQ 39 May 28 00:40:29 np0000001578 kernel: pcieport 0000:00:03.7: AER: enabled with IRQ 39 May 28 00:40:29 np0000001578 kernel: ACPI: \_SB_.GSIE: Enabled at IRQ 20 May 28 00:40:29 np0000001578 kernel: pcieport 0000:00:04.0: PME: Signaling with IRQ 40 May 28 00:40:29 np0000001578 kernel: pcieport 0000:00:04.0: AER: enabled with IRQ 40 May 28 00:40:29 np0000001578 kernel: shpchp 0000:01:00.0: HPC vendor_id 1b36 device_id e ss_vid 0 ss_did 0 May 28 00:40:29 np0000001578 kernel: shpchp 0000:01:00.0: pci_hp_register failed with error -16 May 28 00:40:29 np0000001578 kernel: shpchp 0000:01:00.0: Slot initialization failed May 28 00:40:29 np0000001578 kernel: shpchp: Standard Hot Plug PCI Controller Driver version: 0.4 May 28 00:40:29 np0000001578 kernel: Driver imsttfb not loading because of nomodeset parameter May 28 00:40:29 np0000001578 kernel: Driver asiliantfb not loading because of nomodeset parameter May 28 00:40:29 np0000001578 kernel: input: Power Button as /devices/LNXSYSTM:00/LNXPWRBN:00/input/input0 May 28 00:40:29 np0000001578 kernel: ACPI: button: Power Button [PWRF] May 28 00:40:29 np0000001578 kernel: ACPI: \_SB_.GSIF: Enabled at IRQ 21 May 28 00:40:29 np0000001578 kernel: Freeing initrd memory: 30328K May 28 00:40:29 np0000001578 kernel: Free page reporting enabled May 28 00:40:29 np0000001578 kernel: Serial: 8250/16550 driver, 32 ports, IRQ sharing enabled May 28 00:40:29 np0000001578 kernel: 00:00: ttyS0 at I/O 0x3f8 (irq = 4, base_baud = 115200) is a 16550A May 28 00:40:29 np0000001578 kernel: Linux agpgart interface v0.103 May 28 00:40:29 np0000001578 kernel: loop: module loaded May 28 00:40:29 np0000001578 kernel: virtio_scsi virtio2: 12/0/0 default/read/poll queues May 28 00:40:29 np0000001578 kernel: scsi host0: Virtio SCSI HBA May 28 00:40:29 np0000001578 kernel: ACPI: bus type drm_connector registered May 28 00:40:29 np0000001578 kernel: scsi 0:0:0:0: Direct-Access QEMU QEMU HARDDISK 2.5+ PQ: 0 ANSI: 5 May 28 00:40:29 np0000001578 kernel: tun: Universal TUN/TAP device driver, 1.6 May 28 00:40:29 np0000001578 kernel: scsi 0:0:0:1: Direct-Access QEMU QEMU HARDDISK 2.5+ PQ: 0 ANSI: 5 May 28 00:40:29 np0000001578 kernel: PPP generic driver version 2.4.2 May 28 00:40:29 np0000001578 kernel: uhci_hcd 0000:02:01.0: UHCI Host Controller May 28 00:40:29 np0000001578 kernel: uhci_hcd 0000:02:01.0: new USB bus registered, assigned bus number 1 May 28 00:40:29 np0000001578 kernel: uhci_hcd 0000:02:01.0: detected 2 ports May 28 00:40:29 np0000001578 kernel: uhci_hcd 0000:02:01.0: irq 22, io port 0x0000c000 May 28 00:40:29 np0000001578 kernel: usb usb1: New USB device found, idVendor=1d6b, idProduct=0001, bcdDevice= 6.08 May 28 00:40:29 np0000001578 kernel: usb usb1: New USB device strings: Mfr=3, Product=2, SerialNumber=1 May 28 00:40:29 np0000001578 kernel: usb usb1: Product: UHCI Host Controller May 28 00:40:29 np0000001578 kernel: usb usb1: Manufacturer: Linux 6.8.0-117-generic uhci_hcd May 28 00:40:29 np0000001578 kernel: usb usb1: SerialNumber: 0000:02:01.0 May 28 00:40:29 np0000001578 kernel: hub 1-0:1.0: USB hub found May 28 00:40:29 np0000001578 kernel: hub 1-0:1.0: 2 ports detected May 28 00:40:29 np0000001578 kernel: i8042: PNP: PS/2 Controller [PNP0303:KBD,PNP0f13:MOU] at 0x60,0x64 irq 1,12 May 28 00:40:29 np0000001578 kernel: serio: i8042 KBD port at 0x60,0x64 irq 1 May 28 00:40:29 np0000001578 kernel: serio: i8042 AUX port at 0x60,0x64 irq 12 May 28 00:40:29 np0000001578 kernel: mousedev: PS/2 mouse device common for all mice May 28 00:40:29 np0000001578 kernel: scsi 0:0:0:0: Attached scsi generic sg0 type 0 May 28 00:40:29 np0000001578 kernel: rtc_cmos 00:03: RTC can wake from S4 May 28 00:40:29 np0000001578 kernel: sd 0:0:0:0: Power-on or device reset occurred May 28 00:40:29 np0000001578 kernel: rtc_cmos 00:03: registered as rtc0 May 28 00:40:29 np0000001578 kernel: scsi 0:0:0:1: Attached scsi generic sg1 type 0 May 28 00:40:29 np0000001578 kernel: rtc_cmos 00:03: setting system clock to 2026-05-28T00:40:27 UTC (1779928827) May 28 00:40:29 np0000001578 kernel: sd 0:0:0:0: [sda] 209715200 512-byte logical blocks: (107 GB/100 GiB) May 28 00:40:29 np0000001578 kernel: sd 0:0:0:1: Power-on or device reset occurred May 28 00:40:29 np0000001578 kernel: rtc_cmos 00:03: alarms up to one day, y3k, 242 bytes nvram May 28 00:40:29 np0000001578 kernel: i2c_dev: i2c /dev entries driver May 28 00:40:29 np0000001578 kernel: sd 0:0:0:0: [sda] Write Protect is off May 28 00:40:29 np0000001578 kernel: device-mapper: core: CONFIG_IMA_DISABLE_HTABLE is disabled. Duplicate IMA measurements will not be recorded in the IMA log. May 28 00:40:29 np0000001578 kernel: sd 0:0:0:0: [sda] Mode Sense: 63 00 00 08 May 28 00:40:29 np0000001578 kernel: device-mapper: uevent: version 1.0.3 May 28 00:40:29 np0000001578 kernel: sd 0:0:0:1: [sdb] 482344960 512-byte logical blocks: (247 GB/230 GiB) May 28 00:40:29 np0000001578 kernel: input: AT Translated Set 2 keyboard as /devices/platform/i8042/serio0/input/input1 May 28 00:40:29 np0000001578 kernel: sd 0:0:0:1: [sdb] Write Protect is off May 28 00:40:29 np0000001578 kernel: device-mapper: ioctl: 4.48.0-ioctl (2023-03-01) initialised: dm-devel@redhat.com May 28 00:40:29 np0000001578 kernel: sd 0:0:0:1: [sdb] Mode Sense: 63 00 00 08 May 28 00:40:29 np0000001578 kernel: amd_pstate: the _CPC object is not present in SBIOS or ACPI disabled May 28 00:40:29 np0000001578 kernel: sd 0:0:0:0: [sda] Write cache: enabled, read cache: enabled, doesn't support DPO or FUA May 28 00:40:29 np0000001578 kernel: sd 0:0:0:1: [sdb] Write cache: enabled, read cache: enabled, doesn't support DPO or FUA May 28 00:40:29 np0000001578 kernel: sda: sda1 sda14 sda15 sda16 May 28 00:40:29 np0000001578 kernel: sd 0:0:0:0: [sda] Attached SCSI disk May 28 00:40:29 np0000001578 kernel: ledtrig-cpu: registered to indicate activity on CPUs May 28 00:40:29 np0000001578 kernel: sd 0:0:0:1: [sdb] Attached SCSI disk May 28 00:40:29 np0000001578 kernel: drop_monitor: Initializing network drop monitor service May 28 00:40:29 np0000001578 kernel: NET: Registered PF_INET6 protocol family May 28 00:40:29 np0000001578 kernel: Segment Routing with IPv6 May 28 00:40:29 np0000001578 kernel: In-situ OAM (IOAM) with IPv6 May 28 00:40:29 np0000001578 kernel: NET: Registered PF_PACKET protocol family May 28 00:40:29 np0000001578 kernel: Key type dns_resolver registered May 28 00:40:29 np0000001578 kernel: IPI shorthand broadcast: enabled May 28 00:40:29 np0000001578 kernel: sched_clock: Marking stable (1159003419, 98374263)->(1325836098, -68458416) May 28 00:40:29 np0000001578 kernel: registered taskstats version 1 May 28 00:40:29 np0000001578 kernel: Loading compiled-in X.509 certificates May 28 00:40:29 np0000001578 kernel: Loaded X.509 cert 'Build time autogenerated kernel key: 4616851849424b6aa13d3fe487d4bbc60db2a85f' May 28 00:40:29 np0000001578 kernel: Loaded X.509 cert 'Canonical Ltd. Live Patch Signing 2025 Kmod: d541cef61dc7e793b7eb7e899970a2eef0b5dc8c' May 28 00:40:29 np0000001578 kernel: Loaded X.509 cert 'Canonical Ltd. Live Patch Signing: 14df34d1a87cf37625abec039ef2bf521249b969' May 28 00:40:29 np0000001578 kernel: Loaded X.509 cert 'Canonical Ltd. Kernel Module Signing 2025 Kmod: 4627603d2357a2a3f81006370894c221175893e9' May 28 00:40:29 np0000001578 kernel: Loaded X.509 cert 'Canonical Ltd. Kernel Module Signing: 88f752e560a1e0737e31163a466ad7b70a850c19' May 28 00:40:29 np0000001578 kernel: blacklist: Loading compiled-in revocation X.509 certificates May 28 00:40:29 np0000001578 kernel: Loaded X.509 cert 'Canonical Ltd. Secure Boot Signing: 61482aa2830d0ab2ad5af10b7250da9033ddcef0' May 28 00:40:29 np0000001578 kernel: Loaded X.509 cert 'Canonical Ltd. Secure Boot Signing (2017): 242ade75ac4a15e50d50c84b0d45ff3eae707a03' May 28 00:40:29 np0000001578 kernel: Loaded X.509 cert 'Canonical Ltd. Secure Boot Signing (ESM 2018): 365188c1d374d6b07c3c8f240f8ef722433d6a8b' May 28 00:40:29 np0000001578 kernel: Loaded X.509 cert 'Canonical Ltd. Secure Boot Signing (2019): c0746fd6c5da3ae827864651ad66ae47fe24b3e8' May 28 00:40:29 np0000001578 kernel: Loaded X.509 cert 'Canonical Ltd. Secure Boot Signing (2021 v1): a8d54bbb3825cfb94fa13c9f8a594a195c107b8d' May 28 00:40:29 np0000001578 kernel: Loaded X.509 cert 'Canonical Ltd. Secure Boot Signing (2021 v2): 4cf046892d6fd3c9a5b03f98d845f90851dc6a8c' May 28 00:40:29 np0000001578 kernel: Loaded X.509 cert 'Canonical Ltd. Secure Boot Signing (2021 v3): 100437bb6de6e469b581e61cd66bce3ef4ed53af' May 28 00:40:29 np0000001578 kernel: Loaded X.509 cert 'Canonical Ltd. Secure Boot Signing (Ubuntu Core 2019): c1d57b8f6b743f23ee41f4f7ee292f06eecadfb9' May 28 00:40:29 np0000001578 kernel: Key type .fscrypt registered May 28 00:40:29 np0000001578 kernel: Key type fscrypt-provisioning registered May 28 00:40:29 np0000001578 kernel: cryptd: max_cpu_qlen set to 1000 May 28 00:40:29 np0000001578 kernel: AVX2 version of gcm_enc/dec engaged. May 28 00:40:29 np0000001578 kernel: AES CTR mode by8 optimization enabled May 28 00:40:29 np0000001578 kernel: Key type encrypted registered May 28 00:40:29 np0000001578 kernel: AppArmor: AppArmor sha256 policy hashing enabled May 28 00:40:29 np0000001578 kernel: ima: No TPM chip found, activating TPM-bypass! May 28 00:40:29 np0000001578 kernel: Loading compiled-in module X.509 certificates May 28 00:40:29 np0000001578 kernel: Loaded X.509 cert 'Build time autogenerated kernel key: 4616851849424b6aa13d3fe487d4bbc60db2a85f' May 28 00:40:29 np0000001578 kernel: ima: Allocated hash algorithm: sha256 May 28 00:40:29 np0000001578 kernel: ima: No architecture policies found May 28 00:40:29 np0000001578 kernel: evm: Initialising EVM extended attributes: May 28 00:40:29 np0000001578 kernel: evm: security.selinux May 28 00:40:29 np0000001578 kernel: evm: security.SMACK64 May 28 00:40:29 np0000001578 kernel: evm: security.SMACK64EXEC May 28 00:40:29 np0000001578 kernel: evm: security.SMACK64TRANSMUTE May 28 00:40:29 np0000001578 kernel: evm: security.SMACK64MMAP May 28 00:40:29 np0000001578 kernel: evm: security.apparmor May 28 00:40:29 np0000001578 kernel: evm: security.ima May 28 00:40:29 np0000001578 kernel: evm: security.capability May 28 00:40:29 np0000001578 kernel: evm: HMAC attrs: 0x1 May 28 00:40:29 np0000001578 kernel: PM: Magic number: 10:228:659 May 28 00:40:29 np0000001578 kernel: RAS: Correctable Errors collector initialized. May 28 00:40:29 np0000001578 kernel: clk: Disabling unused clocks May 28 00:40:29 np0000001578 kernel: Freeing unused decrypted memory: 2028K May 28 00:40:29 np0000001578 kernel: Freeing unused kernel image (initmem) memory: 4924K May 28 00:40:29 np0000001578 kernel: Write protecting the kernel read-only data: 38912k May 28 00:40:29 np0000001578 kernel: Freeing unused kernel image (rodata/data gap) memory: 1968K May 28 00:40:29 np0000001578 kernel: x86/mm: Checked W+X mappings: passed, no W+X pages found. May 28 00:40:29 np0000001578 kernel: Run /init as init process May 28 00:40:29 np0000001578 kernel: with arguments: May 28 00:40:29 np0000001578 kernel: /init May 28 00:40:29 np0000001578 kernel: nofb May 28 00:40:29 np0000001578 kernel: with environment: May 28 00:40:29 np0000001578 kernel: HOME=/ May 28 00:40:29 np0000001578 kernel: TERM=linux May 28 00:40:29 np0000001578 kernel: vga=normal May 28 00:40:29 np0000001578 kernel: usb 1-1: new full-speed USB device number 2 using uhci_hcd May 28 00:40:29 np0000001578 kernel: usb 1-1: New USB device found, idVendor=0627, idProduct=0001, bcdDevice= 0.00 May 28 00:40:29 np0000001578 kernel: usb 1-1: New USB device strings: Mfr=1, Product=3, SerialNumber=10 May 28 00:40:29 np0000001578 kernel: usb 1-1: Product: QEMU USB Tablet May 28 00:40:29 np0000001578 kernel: usb 1-1: Manufacturer: QEMU May 28 00:40:29 np0000001578 kernel: usb 1-1: SerialNumber: 28754-0000:00:02.0:00.0:01.0-1 May 28 00:40:29 np0000001578 kernel: hid: raw HID events driver (C) Jiri Kosina May 28 00:40:29 np0000001578 kernel: usbcore: registered new interface driver usbhid May 28 00:40:29 np0000001578 kernel: usbhid: USB HID core driver May 28 00:40:29 np0000001578 kernel: input: QEMU QEMU USB Tablet as /devices/pci0000:00/0000:00:02.0/0000:01:00.0/0000:02:01.0/usb1/1-1/1-1:1.0/0003:0627:0001.0001/input/input3 May 28 00:40:29 np0000001578 kernel: hid-generic 0003:0627:0001.0001: input,hidraw0: USB HID v0.01 Mouse [QEMU QEMU USB Tablet] on usb-0000:02:01.0-1/input0 May 28 00:40:29 np0000001578 kernel: virtio_net virtio1 enp3s0: renamed from eth0 May 28 00:40:29 np0000001578 kernel: virtio_gpu: probe of virtio0 failed with error -22 May 28 00:40:29 np0000001578 kernel: input: VirtualPS/2 VMware VMMouse as /devices/platform/i8042/serio1/input/input5 May 28 00:40:29 np0000001578 kernel: ahci 0000:00:1f.2: version 3.0 May 28 00:40:29 np0000001578 kernel: ACPI: \_SB_.GSIA: Enabled at IRQ 16 May 28 00:40:29 np0000001578 kernel: ahci 0000:00:1f.2: AHCI 0001.0000 32 slots 6 ports 1.5 Gbps 0x3f impl SATA mode May 28 00:40:29 np0000001578 kernel: ahci 0000:00:1f.2: flags: 64bit ncq only May 28 00:40:29 np0000001578 kernel: virtio_net virtio7 enp9s0: renamed from eth3 May 28 00:40:29 np0000001578 kernel: input: VirtualPS/2 VMware VMMouse as /devices/platform/i8042/serio1/input/input4 May 28 00:40:29 np0000001578 kernel: virtio_net virtio8 enp10s0: renamed from eth4 May 28 00:40:29 np0000001578 kernel: scsi host1: ahci May 28 00:40:29 np0000001578 kernel: scsi host2: ahci May 28 00:40:29 np0000001578 kernel: scsi host3: ahci May 28 00:40:29 np0000001578 kernel: scsi host4: ahci May 28 00:40:29 np0000001578 kernel: scsi host5: ahci May 28 00:40:29 np0000001578 kernel: virtio_net virtio5 enp7s0: renamed from eth1 May 28 00:40:29 np0000001578 kernel: scsi host6: ahci May 28 00:40:29 np0000001578 kernel: ata1: SATA max UDMA/133 abar m4096@0xfea22000 port 0xfea22100 irq 76 lpm-pol 0 May 28 00:40:29 np0000001578 kernel: ata2: SATA max UDMA/133 abar m4096@0xfea22000 port 0xfea22180 irq 76 lpm-pol 0 May 28 00:40:29 np0000001578 kernel: ata3: SATA max UDMA/133 abar m4096@0xfea22000 port 0xfea22200 irq 76 lpm-pol 0 May 28 00:40:29 np0000001578 kernel: ata4: SATA max UDMA/133 abar m4096@0xfea22000 port 0xfea22280 irq 76 lpm-pol 0 May 28 00:40:29 np0000001578 kernel: ata5: SATA max UDMA/133 abar m4096@0xfea22000 port 0xfea22300 irq 76 lpm-pol 0 May 28 00:40:29 np0000001578 kernel: ata6: SATA max UDMA/133 abar m4096@0xfea22000 port 0xfea22380 irq 76 lpm-pol 0 May 28 00:40:29 np0000001578 kernel: virtio_net virtio9 enp11s0: renamed from eth5 May 28 00:40:29 np0000001578 kernel: virtio_net virtio6 enp8s0: renamed from eth2 May 28 00:40:29 np0000001578 kernel: ata2: SATA link down (SStatus 0 SControl 300) May 28 00:40:29 np0000001578 kernel: ata5: SATA link down (SStatus 0 SControl 300) May 28 00:40:29 np0000001578 kernel: ata3: SATA link down (SStatus 0 SControl 300) May 28 00:40:29 np0000001578 kernel: ata1: SATA link down (SStatus 0 SControl 300) May 28 00:40:29 np0000001578 kernel: ata4: SATA link down (SStatus 0 SControl 300) May 28 00:40:29 np0000001578 kernel: ata6: SATA link down (SStatus 0 SControl 300) May 28 00:40:29 np0000001578 kernel: raid6: avx2x4 gen() 36660 MB/s May 28 00:40:29 np0000001578 kernel: raid6: avx2x2 gen() 32299 MB/s May 28 00:40:29 np0000001578 kernel: raid6: avx2x1 gen() 23364 MB/s May 28 00:40:29 np0000001578 kernel: raid6: using algorithm avx2x4 gen() 36660 MB/s May 28 00:40:29 np0000001578 kernel: raid6: .... xor() 5126 MB/s, rmw enabled May 28 00:40:29 np0000001578 kernel: raid6: using avx2x2 recovery algorithm May 28 00:40:29 np0000001578 kernel: xor: automatically using best checksumming function avx May 28 00:40:29 np0000001578 kernel: async_tx: api initialized (async) May 28 00:40:29 np0000001578 kernel: Btrfs loaded, zoned=yes, fsverity=yes May 28 00:40:29 np0000001578 kernel: EXT4-fs (sda1): mounted filesystem 8515de1c-ba7e-467b-adde-6d9f8a8dbc1f ro with ordered data mode. Quota mode: none. May 28 00:40:29 np0000001578 kernel: Cgroup memory moving (move_charge_at_immigrate) is deprecated. Please report your usecase to linux-mm@kvack.org if you depend on this functionality. May 28 00:40:29 np0000001578 kernel: Key type psk registered May 28 00:40:29 np0000001578 kernel: EXT4-fs (sda1): re-mounted 8515de1c-ba7e-467b-adde-6d9f8a8dbc1f r/w. May 28 00:40:29 np0000001578 kernel: storpool_rdma: loading out-of-tree module taints kernel. May 28 00:40:29 np0000001578 kernel: storpool_rdma: module verification failed: signature and/or required key missing - tainting kernel May 28 00:40:29 np0000001578 kernel: storpool_rdma: timeInit: tscPerUsec: 2395 May 28 00:40:29 np0000001578 kernel: virtio_net virtio5 iscsi0: renamed from enp7s0 May 28 00:40:29 np0000001578 kernel: virtio_net virtio7 sp-api: renamed from enp9s0 May 28 00:40:29 np0000001578 kernel: virtio_net virtio6 iscsi1: renamed from enp8s0 May 28 00:40:29 np0000001578 kernel: virtio_net virtio9 sp1: renamed from enp11s0 May 28 00:40:29 np0000001578 kernel: virtio_net virtio8 sp0: renamed from enp10s0 May 28 00:40:29 np0000001578 kernel: EXT4-fs (sda16): mounted filesystem 7dc15ce9-d090-44d7-bb05-2a36d545a8e3 r/w with ordered data mode. Quota mode: none. May 28 00:40:29 np0000001578 kernel: kvm_amd: TSC scaling supported May 28 00:40:29 np0000001578 kernel: kvm_amd: Nested Virtualization enabled May 28 00:40:29 np0000001578 kernel: kvm_amd: Nested Paging enabled May 28 00:40:29 np0000001578 kernel: kvm_amd: LBR virtualization supported May 28 00:40:29 np0000001578 kernel: kvm_amd: Virtual VMLOAD VMSAVE supported May 28 00:40:29 np0000001578 kernel: kvm_amd: Virtual GIF supported May 28 00:40:29 np0000001578 kernel: audit: type=1400 audit(1779928829.904:2): apparmor="STATUS" operation="profile_load" profile="unconfined" name=4D6F6E676F444220436F6D70617373 pid=1092 comm="apparmor_parser" May 28 00:40:29 np0000001578 kernel: audit: type=1400 audit(1779928829.904:3): apparmor="STATUS" operation="profile_load" profile="unconfined" name="balena-etcher" pid=1094 comm="apparmor_parser" May 28 00:40:29 np0000001578 kernel: audit: type=1400 audit(1779928829.904:4): apparmor="STATUS" operation="profile_load" profile="unconfined" name="QtWebEngineProcess" pid=1093 comm="apparmor_parser" May 28 00:40:29 np0000001578 kernel: audit: type=1400 audit(1779928829.904:5): apparmor="STATUS" operation="profile_load" profile="unconfined" name="ch-run" pid=1100 comm="apparmor_parser" May 28 00:40:29 np0000001578 kernel: audit: type=1400 audit(1779928829.904:6): apparmor="STATUS" operation="profile_load" profile="unconfined" name="buildah" pid=1096 comm="apparmor_parser" May 28 00:40:29 np0000001578 kernel: audit: type=1400 audit(1779928829.904:7): apparmor="STATUS" operation="profile_load" profile="unconfined" name="ch-checkns" pid=1099 comm="apparmor_parser" May 28 00:40:29 np0000001578 kernel: audit: type=1400 audit(1779928829.904:8): apparmor="STATUS" operation="profile_load" profile="unconfined" name="brave" pid=1095 comm="apparmor_parser" May 28 00:40:29 np0000001578 kernel: audit: type=1400 audit(1779928829.904:9): apparmor="STATUS" operation="profile_load" profile="unconfined" name="chrome" pid=1101 comm="apparmor_parser" May 28 00:40:29 np0000001578 kernel: audit: type=1400 audit(1779928829.904:10): apparmor="STATUS" operation="profile_load" profile="unconfined" name="cam" pid=1098 comm="apparmor_parser" May 28 00:40:35 np0000001578 kernel: kauditd_printk_skb: 112 callbacks suppressed May 28 00:40:35 np0000001578 kernel: audit: type=1400 audit(1779928835.267:123): apparmor="STATUS" operation="profile_replace" info="same as current profile, skipping" profile="unconfined" name="rsyslogd" pid=4977 comm="apparmor_parser" May 28 00:40:35 np0000001578 kernel: loop0: detected capacity change from 0 to 8 May 28 00:40:35 np0000001578 kernel: audit: type=1400 audit(1779928835.556:124): apparmor="STATUS" operation="profile_replace" profile="unconfined" name="/usr/lib/snapd/snap-confine" pid=5148 comm="apparmor_parser" May 28 00:40:35 np0000001578 kernel: audit: type=1400 audit(1779928835.564:125): apparmor="STATUS" operation="profile_replace" profile="unconfined" name="/usr/lib/snapd/snap-confine//mount-namespace-capture-helper" pid=5148 comm="apparmor_parser" May 28 00:41:21 np0000001578 sudo[5350]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-xpedihteqnpidrhfovfptxqiozpzeuat ; cat /proc/sys/kernel/random/boot_id' May 28 00:41:21 np0000001578 sudo[5350]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:41:21 np0000001578 sudo[5350]: pam_unix(sudo:session): session closed for user root May 28 00:41:21 np0000001578 sudo[5356]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-zawevxjbbvyymqzcbqhfnoggorbcefpz ; whoami' May 28 00:41:21 np0000001578 sudo[5356]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:41:21 np0000001578 sudo[5356]: pam_unix(sudo:session): session closed for user root May 28 00:41:28 np0000001578 sudo[6188]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-pyeggnqnuxeflewgofnaafjmmiyrfyle ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928888.232165-10822-223480606522745/AnsiballZ_ufw.py' May 28 00:41:28 np0000001578 sudo[6188]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:41:29 np0000001578 sudo[6188]: pam_unix(sudo:session): session closed for user root May 28 00:41:29 np0000001578 sudo[6237]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-vgeqqvwswyxsfgxivkjtrmsrnthtnbed ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928889.1306174-10822-207472248888082/AnsiballZ_ufw.py' May 28 00:41:29 np0000001578 sudo[6237]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:41:29 np0000001578 sudo[6237]: pam_unix(sudo:session): session closed for user root May 28 00:41:29 np0000001578 sudo[6281]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-wlnalnvgiogzsjtuhjofygklzrjnhnob ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928889.8347476-10822-135765197518193/AnsiballZ_ufw.py' May 28 00:41:29 np0000001578 sudo[6281]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:41:30 np0000001578 sudo[6281]: pam_unix(sudo:session): session closed for user root May 28 00:41:31 np0000001578 sudo[6410]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-amylnahabqxfpvcximkyjshiqxezbqid ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928891.2454867-10852-258599893307253/AnsiballZ_command.py' May 28 00:41:31 np0000001578 sudo[6410]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:41:31 np0000001578 sudo[6410]: pam_unix(sudo:session): session closed for user root May 28 00:41:32 np0000001578 sudo[6438]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-jgcshciitmmgkqxyxhprkhjxsnbvbjra ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928892.103154-10865-166781808966878/AnsiballZ_command.py' May 28 00:41:32 np0000001578 sudo[6438]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:41:32 np0000001578 sudo[6438]: pam_unix(sudo:session): session closed for user root May 28 00:41:33 np0000001578 sudo[6476]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-ukiocdffmnzmncjqnzibbjtoqhibcqbm ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928893.027111-10874-107059270077987/AnsiballZ_service_facts.py' May 28 00:41:33 np0000001578 sudo[6476]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:41:36 np0000001578 sudo[6476]: pam_unix(sudo:session): session closed for user root May 28 00:41:37 np0000001578 sudo[7073]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-wekyxdxylgxjjqkuxtcgsyohrygwdrhe ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928897.4856691-10892-252218283215740/AnsiballZ_file.py' May 28 00:41:37 np0000001578 sudo[7073]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:41:37 np0000001578 sudo[7073]: pam_unix(sudo:session): session closed for user root May 28 00:41:37 np0000001578 sudo[7096]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-gggtfwtrbfdexyqxruhmvhvmyhhlfhke ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928897.8885405-10900-226018768791829/AnsiballZ_systemd.py' May 28 00:41:37 np0000001578 sudo[7096]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:41:38 np0000001578 sudo[7096]: pam_unix(sudo:session): session closed for user root May 28 00:41:38 np0000001578 sudo[7133]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-dzmvgecvonvbemgwngaycqcnnepkfyuo ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928898.4871936-10909-37122744663977/AnsiballZ_command.py' May 28 00:41:38 np0000001578 sudo[7133]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:41:38 np0000001578 sudo[7133]: pam_unix(sudo:session): session closed for user root May 28 00:41:39 np0000001578 sudo[7163]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-tjlnrkozxdedysablnudjbfhtxudrlxl ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928899.115732-10918-187488275782051/AnsiballZ_stat.py' May 28 00:41:39 np0000001578 sudo[7163]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:41:39 np0000001578 sudo[7163]: pam_unix(sudo:session): session closed for user root May 28 00:41:39 np0000001578 sudo[7177]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-unrytwfvkisemnheakevnvtihsqiwcfi ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928899.115732-10918-187488275782051/AnsiballZ_copy.py' May 28 00:41:39 np0000001578 sudo[7177]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:41:39 np0000001578 sudo[7177]: pam_unix(sudo:session): session closed for user root May 28 00:41:39 np0000001578 sudo[7200]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-mugenotoobgcrnscpnvhbrwyreejkigi ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928899.8184266-10933-52942317063655/AnsiballZ_copy.py' May 28 00:41:39 np0000001578 sudo[7200]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:41:40 np0000001578 sudo[7200]: pam_unix(sudo:session): session closed for user root May 28 00:41:41 np0000001578 sudo[7254]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-eewnssugkmjvyhtpxhkbuemfktoqcygm ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928900.90868-10956-192292222816072/AnsiballZ_slurp.py' May 28 00:41:41 np0000001578 sudo[7254]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:41:41 np0000001578 sudo[7254]: pam_unix(sudo:session): session closed for user root May 28 00:41:41 np0000001578 sudo[7277]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-rwgwbdwjtfzpopjanfrncwtzxhmpexou ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928901.6184602-10967-165613541586683/AnsiballZ_command.py' May 28 00:41:41 np0000001578 sudo[7277]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:41:42 np0000001578 kernel: sdb: sdb1 May 28 00:41:44 np0000001578 sudo[7277]: pam_unix(sudo:session): session closed for user root May 28 00:41:44 np0000001578 sudo[7348]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-irycjsrogojccaiqqafbvvcxhbjzxzxv ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928904.7744176-10976-152413800012366/AnsiballZ_systemd.py' May 28 00:41:44 np0000001578 sudo[7348]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:41:45 np0000001578 sudo[7348]: pam_unix(sudo:session): session closed for user root May 28 00:41:45 np0000001578 sudo[7387]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-futircohvienrytmitbwrypniuxpkavc ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928905.394421-10985-168132421925221/AnsiballZ_stat.py' May 28 00:41:45 np0000001578 sudo[7387]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:41:45 np0000001578 sudo[7387]: pam_unix(sudo:session): session closed for user root May 28 00:41:45 np0000001578 sudo[7401]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-sgnmhvdacorsrmzgzztpkfhrsfbgqmyb ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928905.394421-10985-168132421925221/AnsiballZ_copy.py' May 28 00:41:45 np0000001578 sudo[7401]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:41:46 np0000001578 sudo[7401]: pam_unix(sudo:session): session closed for user root May 28 00:41:46 np0000001578 sudo[7424]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-rffnsabqetjwgcfttgxhtpnuqmlippax ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928906.1910553-11002-59333390783871/AnsiballZ_stat.py' May 28 00:41:46 np0000001578 sudo[7424]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:41:46 np0000001578 sudo[7424]: pam_unix(sudo:session): session closed for user root May 28 00:41:47 np0000001578 sudo[7469]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-fqplejglvwizweduvdpuscmhprwnjasb ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928907.0147927-11020-244423871799043/AnsiballZ_command.py' May 28 00:41:47 np0000001578 sudo[7469]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:41:47 np0000001578 sudo[7469]: pam_unix(sudo:session): session closed for user root May 28 00:41:47 np0000001578 sudo[7497]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-khjbszlinlknhnwqmpiefswhsecjuruv ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928907.5430686-11031-154479641724047/AnsiballZ_command.py' May 28 00:41:47 np0000001578 sudo[7497]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:41:48 np0000001578 sudo[7497]: pam_unix(sudo:session): session closed for user root May 28 00:41:48 np0000001578 sudo[7524]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-prjxyjrphmrbjhdgvcswxxhndzbovdku ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928908.1663535-11040-129428084209161/AnsiballZ_systemd.py' May 28 00:41:48 np0000001578 sudo[7524]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:41:48 np0000001578 sudo[7524]: pam_unix(sudo:session): session closed for user root May 28 00:41:48 np0000001578 sudo[7549]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-sauesrrfzpvecipcmlfqkwhsejgpgwpb ; CGCONFIG_FORCE_STARTUP=1 /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928908.79937-11049-189283185539363/AnsiballZ_command.py' May 28 00:41:48 np0000001578 sudo[7549]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:41:49 np0000001578 sudo[7549]: pam_unix(sudo:session): session closed for user root May 28 00:41:51 np0000001578 sudo[7790]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-nurwayztuxgcbpagkldzofeahqwkyqrk ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928911.6884043-11083-9962838026732/AnsiballZ_command.py' May 28 00:41:51 np0000001578 sudo[7790]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:41:52 np0000001578 sudo[7790]: pam_unix(sudo:session): session closed for user root May 28 00:41:52 np0000001578 sudo[7817]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-uerwmqcnsrjhfiptumgvpscnastynryc ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928912.3370364-11091-229909203152634/AnsiballZ_command.py' May 28 00:41:52 np0000001578 sudo[7817]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:41:53 np0000001578 sudo[7817]: pam_unix(sudo:session): session closed for user root May 28 00:41:53 np0000001578 sudo[7972]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-zqdrsbtmwjmmiodmkejxwzoxjxvfihmj ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1779928913.8275924-11099-134066816586946/AnsiballZ_command.py' May 28 00:41:53 np0000001578 sudo[7972]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:41:56 np0000001578 kernel: storpool_pci 0000:07:00.0: probing May 28 00:41:56 np0000001578 kernel: storpool_pci 0000:07:00.0: device registered, physDev 0000:07:00.0 May 28 00:41:56 np0000001578 kernel: storpool_pci 0000:08:00.0: probing May 28 00:41:56 np0000001578 kernel: storpool_pci 0000:08:00.0: device registered, physDev 0000:08:00.0 May 28 00:41:56 np0000001578 kernel: storpool_bd: timeInit: tscPerUsec: 2395 May 28 00:41:56 np0000001578 sudo[7972]: pam_unix(sudo:session): session closed for user root May 28 00:41:57 np0000001578 kernel: block sdb: the capability attribute has been deprecated. May 28 00:41:57 np0000001578 kernel: storpool_disk: closeDisk: service 8219: disk sda closed May 28 00:41:58 np0000001578 sudo[8641]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-awoaougmsobfazvzgvmpouucqenbulxq ; /usr/bin/python3' May 28 00:41:58 np0000001578 sudo[8641]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:41:58 np0000001578 sudo[8641]: pam_unix(sudo:session): session closed for user root May 28 00:41:59 np0000001578 sudo[8713]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-ffamkcwdaskukdbytayarughhkoffxfd ; /usr/bin/python3' May 28 00:41:59 np0000001578 sudo[8713]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:42:00 np0000001578 sudo[8713]: pam_unix(sudo:session): session closed for user root May 28 00:42:00 np0000001578 kernel: virtio_net virtio7 sp-api: entered promiscuous mode May 28 00:42:00 np0000001578 kernel: virtio_net virtio7 sp-api: left promiscuous mode May 28 00:42:00 np0000001578 kernel: virtio_net virtio7 sp-api: entered promiscuous mode May 28 00:42:00 np0000001578 kernel: virtio_net virtio7 sp-api: left promiscuous mode May 28 00:42:00 np0000001578 kernel: virtio_net virtio7 sp-api: entered promiscuous mode May 28 00:42:00 np0000001578 kernel: virtio_net virtio7 sp-api: left promiscuous mode May 28 00:42:00 np0000001578 kernel: virtio_net virtio7 sp-api: entered promiscuous mode May 28 00:42:00 np0000001578 kernel: virtio_net virtio7 sp-api: left promiscuous mode May 28 00:42:00 np0000001578 kernel: virtio_net virtio7 sp-api: entered promiscuous mode May 28 00:42:00 np0000001578 kernel: virtio_net virtio7 sp-api: left promiscuous mode May 28 00:42:00 np0000001578 kernel: virtio_net virtio7 sp-api: entered promiscuous mode May 28 00:42:00 np0000001578 kernel: virtio_net virtio7 sp-api: left promiscuous mode May 28 00:42:01 np0000001578 sudo[8734]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-zuhznyqmglmtpgylglsukoskleefgpbw ; /usr/bin/python3' May 28 00:42:01 np0000001578 sudo[8734]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:42:01 np0000001578 sudo[8734]: pam_unix(sudo:session): session closed for user root May 28 00:42:01 np0000001578 sudo[8749]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-paolkdwatxizvlrmiyqpjdzwfgahlxqp ; /usr/bin/python3' May 28 00:42:01 np0000001578 sudo[8749]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:42:02 np0000001578 sudo[8749]: pam_unix(sudo:session): session closed for user root May 28 00:42:02 np0000001578 sudo[8788]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-pvyencrmnagcfmjxhlsetojlpcnztmft ; /usr/bin/python3' May 28 00:42:02 np0000001578 sudo[8788]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:42:02 np0000001578 sudo[8788]: pam_unix(sudo:session): session closed for user root May 28 00:42:02 np0000001578 sudo[8801]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-fzlnpklrzfgdnanyvracgsghhihmuphy ; /usr/bin/python3' May 28 00:42:02 np0000001578 sudo[8801]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:42:02 np0000001578 sudo[8801]: pam_unix(sudo:session): session closed for user root May 28 00:42:02 np0000001578 sudo[8815]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-mhtfyxcquhpqnuzcuegmmlzeczdblcqn ; /usr/bin/python3' May 28 00:42:02 np0000001578 sudo[8815]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:42:03 np0000001578 sudo[8815]: pam_unix(sudo:session): session closed for user root May 28 00:42:03 np0000001578 sudo[8840]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-anfljleyhshjtazmitqkdljqfemotvkv ; /usr/bin/python3' May 28 00:42:03 np0000001578 sudo[8840]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:42:03 np0000001578 sudo[8840]: pam_unix(sudo:session): session closed for user root May 28 00:42:03 np0000001578 sudo[8851]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-fmvothfqypvtyqjznbcllydffqxbuswf ; /usr/bin/python3' May 28 00:42:03 np0000001578 sudo[8851]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:42:03 np0000001578 sudo[8851]: pam_unix(sudo:session): session closed for user root May 28 00:42:04 np0000001578 sudo[8864]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-sksaffjuqthheednvechsmvrljwmncxt ; /usr/bin/python3' May 28 00:42:04 np0000001578 sudo[8864]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:42:04 np0000001578 sudo[8864]: pam_unix(sudo:session): session closed for user root May 28 00:42:04 np0000001578 sudo[8894]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-mkcvnqacolftpmcqvftxdqymshfnnoqf ; /usr/bin/python3' May 28 00:42:04 np0000001578 sudo[8894]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:42:04 np0000001578 sudo[8894]: pam_unix(sudo:session): session closed for user root May 28 00:42:04 np0000001578 sudo[8905]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-oskaljpeyxytbxdwuskvympnnimkbosg ; /usr/bin/python3' May 28 00:42:04 np0000001578 sudo[8905]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 00:42:05 np0000001578 sudo[8905]: pam_unix(sudo:session): session closed for user root May 28 01:19:20 np0000001578 kernel: storpool_rdma: netdevNotifier: our interface sp0 is going down! May 28 01:19:20 np0000001578 kernel: storpool_rdma: netdevNotifier: our interface sp0 is going down! May 28 01:19:22 np0000001578 kernel: storpool_rdma: netdevNotifier: our interface sp1 is going down! May 28 01:19:22 np0000001578 kernel: storpool_rdma: netdevNotifier: our interface sp1 is going down! May 28 01:19:44 np0000001578 kernel: sd 0:0:0:1: [sdb] Synchronizing SCSI cache May 28 01:19:44 np0000001578 kernel: sd 0:0:0:1: LUN assignments on this target have changed. The Linux SCSI layer does not automatically remap LUN assignments. May 28 01:19:44 np0000001578 kernel: sd 0:0:0:1: [sdb] Synchronize Cache(10) failed: Result: hostbyte=DID_OK driverbyte=DRIVER_OK May 28 01:19:44 np0000001578 kernel: sd 0:0:0:1: [sdb] Sense Key : Illegal Request [current] May 28 01:19:44 np0000001578 kernel: sd 0:0:0:1: [sdb] Add. Sense: Logical unit not supported May 28 01:20:23 np0000001578 sudo[18919]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-bbkjrwxwzlesohmieunqzbzggfecjxca ; /usr/bin/python3' May 28 01:20:23 np0000001578 sudo[18919]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 01:20:23 np0000001578 sudo[18919]: pam_unix(sudo:session): session closed for user root May 28 01:20:23 np0000001578 sudo[18929]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-accawinvpwgfvfydtikefxzwxqsozcek ; /usr/bin/python3' May 28 01:20:23 np0000001578 sudo[18929]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) May 28 01:20:24 np0000001578 sudo[18929]: pam_unix(sudo:session): session closed for user root May 28 01:20:27 np0000001578 kernel: storpool_disk: closeDisk: service 8219: disk sdb closed May 28 01:20:28 np0000001578 kernel: storpool_disk: closeDisk: service 18963: disk sda closed May 28 01:20:30 np0000001578 kernel: storpool_disk: closeDisk: service 18988: disk sda closed May 28 01:20:32 np0000001578 kernel: storpool_disk: closeDisk: service 19013: disk sda closed May 28 01:20:37 np0000001578 sudo[19045]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-nsycoanrbskozvivticqmffiidfnqvno ; /usr/bin/python3' May 28 01:20:37 np0000001578 sudo[19045]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)