Jul 15 12:57:30 np0000005197 sudo[2294]: pam_unix(sudo:session): session closed for user root Jul 15 12:57:30 np0000005197 sudo[2312]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-gzzuygugzihnnsdbsiirjlqrfzmzogwk ; /usr/bin/python3' Jul 15 12:57:30 np0000005197 sudo[2312]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 12:57:30 np0000005197 sudo[2312]: pam_unix(sudo:session): session closed for user root Jul 15 12:57:30 np0000005197 sudo[2321]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-xricrmkmpgafywbyaxbzhdqcfvaubahj ; /usr/bin/python3' Jul 15 12:57:30 np0000005197 sudo[2321]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 12:57:30 np0000005197 sudo[2321]: pam_unix(sudo:session): session closed for user root Jul 15 12:57:34 np0000005197 sudo[2335]: ubuntu : PWD=/home/ubuntu ; USER=stack ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-yscqilxewqblwfoybmpuwjbkyrnbxmzq ; /usr/bin/python3' Jul 15 12:57:34 np0000005197 sudo[2335]: pam_unix(sudo:session): session opened for user stack(uid=1002) by ubuntu(uid=1000) Jul 15 12:57:34 np0000005197 sudo[2335]: pam_unix(sudo:session): session closed for user stack Jul 15 12:57:36 np0000005197 sudo[2392]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-szhzplnmouctoeqhvmpjlnvdzwvtuytp ; /usr/bin/python3' Jul 15 12:57:36 np0000005197 sudo[2392]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 12:57:36 np0000005197 sudo[2392]: pam_unix(sudo:session): session closed for user root Jul 15 12:57:36 np0000005197 sudo[2397]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-jhblgvkdavlnltecvambvntztmidykof ; /usr/bin/python3' Jul 15 12:57:36 np0000005197 sudo[2397]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 12:57:36 np0000005197 sudo[2397]: pam_unix(sudo:session): session closed for user root Jul 15 12:57:37 np0000005197 sudo[2402]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-rdwpaqebqbjgmsbixcjrtorsgxyycczc ; /usr/bin/python3' Jul 15 12:57:37 np0000005197 sudo[2402]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 12:57:38 np0000005197 sudo[2402]: pam_unix(sudo:session): session closed for user root Jul 15 12:57:38 np0000005197 sudo[2564]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-bufdcmdddjrnytotuaexolkefrppxrqm ; /usr/bin/python3' Jul 15 12:57:38 np0000005197 sudo[2564]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 12:57:38 np0000005197 sudo[2564]: pam_unix(sudo:session): session closed for user root Jul 15 12:57:38 np0000005197 sudo[2646]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-vsbrgkhgvvqtayxjccohklcyrbolwkmc ; /usr/bin/python3' Jul 15 12:57:38 np0000005197 sudo[2646]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 12:57:38 np0000005197 sudo[2646]: pam_unix(sudo:session): session closed for user root Jul 15 12:57:38 np0000005197 sudo[2700]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-ktjylxzsftssgueppbriglkijaawpjvl ; /usr/bin/python3' Jul 15 12:57:38 np0000005197 sudo[2700]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 12:57:39 np0000005197 sudo[2700]: pam_unix(sudo:session): session closed for user root Jul 15 12:57:39 np0000005197 sudo[2747]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-fzjplocgtaenmijgzutzxqwknhzfwsks ; /usr/bin/python3' Jul 15 12:57:39 np0000005197 sudo[2747]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 12:57:39 np0000005197 sudo[2747]: pam_unix(sudo:session): session closed for user root Jul 15 12:57:40 np0000005197 sudo[2795]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-xadintoaoqvxwcxnhwipuqapopsfrdiu ; /usr/bin/python3' Jul 15 12:57:40 np0000005197 sudo[2795]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 12:57:40 np0000005197 sudo[2795]: pam_unix(sudo:session): session closed for user root Jul 15 12:57:42 np0000005197 sudo[2863]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-fjhpzttouzhqdldkjatlwyxyihypjlqc ; /usr/bin/python3' Jul 15 12:57:42 np0000005197 sudo[2863]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 12:58:06 np0000005197 sudo[2863]: pam_unix(sudo:session): session closed for user root Jul 15 12:58:15 np0000005197 sudo[7937]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-gjkjtnxblnfhqtvknhojdsraypvfquwu ; /usr/bin/python3' Jul 15 12:58:15 np0000005197 sudo[7937]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 12:58:15 np0000005197 sudo[7937]: pam_unix(sudo:session): session closed for user root Jul 15 12:58:15 np0000005197 sudo[7945]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-vpsklgubkhpfytyeuipyrwgrloogjyet ; /usr/bin/python3' Jul 15 12:58:15 np0000005197 sudo[7945]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 12:58:15 np0000005197 sudo[7945]: pam_unix(sudo:session): session closed for user root Jul 15 12:59:28 np0000005197 kernel: pci 0000:07:00.0: [1af4:1041] type 00 class 0x020000 PCIe Endpoint Jul 15 12:59:28 np0000005197 kernel: pci 0000:07:00.0: BAR 1 [mem 0x00000000-0x00000fff] Jul 15 12:59:28 np0000005197 kernel: pci 0000:07:00.0: BAR 4 [mem 0x00000000-0x00003fff 64bit pref] Jul 15 12:59:28 np0000005197 kernel: pci 0000:07:00.0: ROM [mem 0x00000000-0x0007ffff pref] Jul 15 12:59:28 np0000005197 kernel: pci 0000:07:00.0: ROM [mem 0xfe000000-0xfe07ffff pref]: assigned Jul 15 12:59:28 np0000005197 kernel: pci 0000:07:00.0: BAR 4 [mem 0xc160000000-0xc160003fff 64bit pref]: assigned Jul 15 12:59:28 np0000005197 kernel: pci 0000:07:00.0: BAR 1 [mem 0xfe080000-0xfe080fff]: assigned Jul 15 12:59:28 np0000005197 kernel: virtio-pci 0000:07:00.0: enabling device (0000 -> 0002) Jul 15 12:59:28 np0000005197 kernel: virtio_net virtio5 enp7s0: renamed from eth0 Jul 15 12:59:38 np0000005197 kernel: pci 0000:08:00.0: [1af4:1041] type 00 class 0x020000 PCIe Endpoint Jul 15 12:59:38 np0000005197 kernel: pci 0000:08:00.0: BAR 1 [mem 0x00000000-0x00000fff] Jul 15 12:59:38 np0000005197 kernel: pci 0000:08:00.0: BAR 4 [mem 0x00000000-0x00003fff 64bit pref] Jul 15 12:59:38 np0000005197 kernel: pci 0000:08:00.0: ROM [mem 0x00000000-0x0007ffff pref] Jul 15 12:59:38 np0000005197 kernel: pci 0000:08:00.0: ROM [mem 0xfde00000-0xfde7ffff pref]: assigned Jul 15 12:59:38 np0000005197 kernel: pci 0000:08:00.0: BAR 4 [mem 0xc140000000-0xc140003fff 64bit pref]: assigned Jul 15 12:59:38 np0000005197 kernel: pci 0000:08:00.0: BAR 1 [mem 0xfde80000-0xfde80fff]: assigned Jul 15 12:59:38 np0000005197 kernel: virtio-pci 0000:08:00.0: enabling device (0000 -> 0002) Jul 15 12:59:38 np0000005197 kernel: virtio_net virtio6 enp8s0: renamed from eth0 Jul 15 13:00:13 np0000005197 sudo[8035]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-ccebmpnldmctlufnuszxzjqgfednqkkt ; /usr/bin/python3' Jul 15 13:00:13 np0000005197 sudo[8035]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:00:14 np0000005197 sudo[8035]: pam_unix(sudo:session): session closed for user root Jul 15 13:00:14 np0000005197 sudo[8044]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-xqqjvrdvnohxotbmugnpcrdhafhfsejy ; /usr/bin/python3' Jul 15 13:00:14 np0000005197 sudo[8044]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:00:14 np0000005197 sudo[8044]: pam_unix(sudo:session): session closed for user root Jul 15 13:00:15 np0000005197 sudo[8053]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-hvsuhiyorybkovyzbkabeslxhwojjmmn ; /usr/bin/python3' Jul 15 13:00:15 np0000005197 sudo[8053]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:00:15 np0000005197 sudo[8053]: pam_unix(sudo:session): session closed for user root Jul 15 13:00:16 np0000005197 sudo[8108]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-hjhptuplclqygxahvcpkyyoelwrkball ; /usr/bin/python3' Jul 15 13:00:16 np0000005197 sudo[8108]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:00:16 np0000005197 kernel: virtio_net virtio5 iscsi0: renamed from enp7s0 Jul 15 13:00:16 np0000005197 kernel: virtio_net virtio6 iscsi1: renamed from enp8s0 Jul 15 13:00:16 np0000005197 kernel: 8021q: adding VLAN 0 to HW filter on device iscsi1 Jul 15 13:00:16 np0000005197 kernel: 8021q: adding VLAN 0 to HW filter on device iscsi0 Jul 15 13:00:16 np0000005197 sudo[8108]: pam_unix(sudo:session): session closed for user root Jul 15 13:00:53 np0000005197 kernel: pci 0000:09:00.0: [1af4:1041] type 00 class 0x020000 PCIe Endpoint Jul 15 13:00:53 np0000005197 kernel: pci 0000:09:00.0: BAR 1 [mem 0x00000000-0x00000fff] Jul 15 13:00:53 np0000005197 kernel: pci 0000:09:00.0: BAR 4 [mem 0x00000000-0x00003fff 64bit pref] Jul 15 13:00:53 np0000005197 kernel: pci 0000:09:00.0: ROM [mem 0x00000000-0x0007ffff pref] Jul 15 13:00:53 np0000005197 kernel: pci 0000:09:00.0: ROM [mem 0xfdc00000-0xfdc7ffff pref]: assigned Jul 15 13:00:53 np0000005197 kernel: pci 0000:09:00.0: BAR 4 [mem 0xc120000000-0xc120003fff 64bit pref]: assigned Jul 15 13:00:53 np0000005197 kernel: pci 0000:09:00.0: BAR 1 [mem 0xfdc80000-0xfdc80fff]: assigned Jul 15 13:00:53 np0000005197 kernel: virtio-pci 0000:09:00.0: enabling device (0000 -> 0002) Jul 15 13:00:53 np0000005197 kernel: virtio_net virtio7 enp9s0: renamed from eth0 Jul 15 13:01:04 np0000005197 kernel: pci 0000:0a:00.0: [1af4:1041] type 00 class 0x020000 PCIe Endpoint Jul 15 13:01:04 np0000005197 kernel: pci 0000:0a:00.0: BAR 1 [mem 0x00000000-0x00000fff] Jul 15 13:01:04 np0000005197 kernel: pci 0000:0a:00.0: BAR 4 [mem 0x00000000-0x00003fff 64bit pref] Jul 15 13:01:04 np0000005197 kernel: pci 0000:0a:00.0: ROM [mem 0x00000000-0x0007ffff pref] Jul 15 13:01:04 np0000005197 kernel: pci 0000:0a:00.0: ROM [mem 0xfda00000-0xfda7ffff pref]: assigned Jul 15 13:01:04 np0000005197 kernel: pci 0000:0a:00.0: BAR 4 [mem 0xc100000000-0xc100003fff 64bit pref]: assigned Jul 15 13:01:04 np0000005197 kernel: pci 0000:0a:00.0: BAR 1 [mem 0xfda80000-0xfda80fff]: assigned Jul 15 13:01:04 np0000005197 kernel: virtio-pci 0000:0a:00.0: enabling device (0000 -> 0002) Jul 15 13:01:04 np0000005197 kernel: virtio_net virtio8 enp10s0: renamed from eth0 Jul 15 13:01:15 np0000005197 kernel: pci 0000:0b:00.0: [1af4:1041] type 00 class 0x020000 PCIe Endpoint Jul 15 13:01:15 np0000005197 kernel: pci 0000:0b:00.0: BAR 1 [mem 0x00000000-0x00000fff] Jul 15 13:01:15 np0000005197 kernel: pci 0000:0b:00.0: BAR 4 [mem 0x00000000-0x00003fff 64bit pref] Jul 15 13:01:15 np0000005197 kernel: pci 0000:0b:00.0: ROM [mem 0x00000000-0x0007ffff pref] Jul 15 13:01:15 np0000005197 kernel: pci 0000:0b:00.0: ROM [mem 0xfd800000-0xfd87ffff pref]: assigned Jul 15 13:01:15 np0000005197 kernel: pci 0000:0b:00.0: BAR 4 [mem 0xc0e0000000-0xc0e0003fff 64bit pref]: assigned Jul 15 13:01:15 np0000005197 kernel: pci 0000:0b:00.0: BAR 1 [mem 0xfd880000-0xfd880fff]: assigned Jul 15 13:01:15 np0000005197 kernel: virtio-pci 0000:0b:00.0: enabling device (0000 -> 0002) Jul 15 13:01:15 np0000005197 kernel: virtio_net virtio9 enp11s0: renamed from eth0 Jul 15 13:01:47 np0000005197 kernel: scsi 0:0:0:1: Direct-Access QEMU QEMU HARDDISK 2.5+ PQ: 0 ANSI: 5 Jul 15 13:01:47 np0000005197 kernel: sd 0:0:0:1: Power-on or device reset occurred Jul 15 13:01:47 np0000005197 kernel: sd 0:0:0:1: Attached scsi generic sg1 type 0 Jul 15 13:01:47 np0000005197 kernel: sd 0:0:0:1: LUN assignments on this target have changed. The Linux SCSI layer does not automatically remap LUN assignments. Jul 15 13:01:47 np0000005197 kernel: sd 0:0:0:1: [sdb] 482344960 512-byte logical blocks: (247 GB/230 GiB) Jul 15 13:01:47 np0000005197 kernel: sd 0:0:0:1: [sdb] Write Protect is off Jul 15 13:01:47 np0000005197 kernel: sd 0:0:0:1: [sdb] Mode Sense: 63 00 00 08 Jul 15 13:01:47 np0000005197 kernel: sd 0:0:0:1: [sdb] Write cache: enabled, read cache: enabled, doesn't support DPO or FUA Jul 15 13:01:47 np0000005197 kernel: sd 0:0:0:1: [sdb] Attached SCSI disk Jul 15 13:01:49 np0000005197 sudo[8329]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-rwxzmluiojqcybyfegcocsrxeyazvwaf ; /usr/bin/python3' Jul 15 13:01:49 np0000005197 sudo[8329]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:01:49 np0000005197 sudo[8329]: pam_unix(sudo:session): session closed for user root Jul 15 13:01:49 np0000005197 sudo[8340]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-gwwiifrrkvgaxuoutwioxtimlkktrdni ; /usr/bin/python3' Jul 15 13:01:49 np0000005197 sudo[8340]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:01:49 np0000005197 sudo[8340]: pam_unix(sudo:session): session closed for user root Jul 15 13:01:50 np0000005197 sudo[8348]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-ubcvlrcmodmhyelcpbalquflcrplokjc ; /usr/bin/python3' Jul 15 13:01:50 np0000005197 sudo[8348]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:01:50 np0000005197 sudo[8348]: pam_unix(sudo:session): session closed for user root Jul 15 13:01:50 np0000005197 sudo[8402]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-ntmthxfuvqudvqgkbixhetbztuaamkwp ; /usr/bin/python3' Jul 15 13:01:50 np0000005197 sudo[8402]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:01:51 np0000005197 kernel: virtio_net virtio7 sp-api: renamed from enp9s0 Jul 15 13:01:51 np0000005197 kernel: virtio_net virtio8 sp0: renamed from enp10s0 Jul 15 13:01:51 np0000005197 kernel: virtio_net virtio9 sp1: renamed from enp11s0 Jul 15 13:01:51 np0000005197 kernel: 8021q: adding VLAN 0 to HW filter on device sp1 Jul 15 13:01:51 np0000005197 kernel: 8021q: adding VLAN 0 to HW filter on device sp0 Jul 15 13:01:51 np0000005197 kernel: 8021q: adding VLAN 0 to HW filter on device sp-api Jul 15 13:01:51 np0000005197 sudo[8402]: pam_unix(sudo:session): session closed for user root Jul 15 13:02:39 np0000005197 sudo[8638]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-okkxcfqavfkbrilxpwpctcflijaywtjh ; cat /etc/os-release' Jul 15 13:02:39 np0000005197 sudo[8638]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:02:39 np0000005197 sudo[8638]: pam_unix(sudo:session): session closed for user root Jul 15 13:02:39 np0000005197 sudo[8642]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-jeennxdulwhzshccjblfkrjhzyfsfzti ; apt-get update && env DEBIAN_FRONTEND=noninteractive apt-get install -y python3' Jul 15 13:02:39 np0000005197 sudo[8642]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:02:41 np0000005197 sudo[8642]: pam_unix(sudo:session): session closed for user root Jul 15 13:02:43 np0000005197 sudo[9028]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-hnikumaifsuupshxadxebrnxhnzgkkdp ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120562.9342358-10026-83920050598481/AnsiballZ_apt.py' Jul 15 13:02:43 np0000005197 sudo[9028]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:02:44 np0000005197 sudo[9028]: pam_unix(sudo:session): session closed for user root Jul 15 13:02:45 np0000005197 sudo[9310]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-gywkvvdavefliyngueqodqeadlzofcws ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120564.9849434-10034-240528322048242/AnsiballZ_apt.py' Jul 15 13:02:45 np0000005197 sudo[9310]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:02:53 np0000005197 sudo[9310]: pam_unix(sudo:session): session closed for user root Jul 15 13:02:54 np0000005197 sudo[14891]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-kmvwgkvdwdqldzxcdephhetouibqekuw ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120573.9121518-10044-57119187729987/AnsiballZ_get_url.py' Jul 15 13:02:54 np0000005197 sudo[14891]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:02:54 np0000005197 sudo[14891]: pam_unix(sudo:session): session closed for user root Jul 15 13:02:54 np0000005197 sudo[14909]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-cpytmrskneuyqdgretdqxxxoqydvjwgh ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120574.508435-10052-150105466324468/AnsiballZ_stat.py' Jul 15 13:02:54 np0000005197 sudo[14909]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:02:54 np0000005197 sudo[14909]: pam_unix(sudo:session): session closed for user root Jul 15 13:02:55 np0000005197 sudo[14920]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-meljbptaxjwoteoyimftpexsdhbrglkv ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120574.508435-10052-150105466324468/AnsiballZ_copy.py' Jul 15 13:02:55 np0000005197 sudo[14920]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:02:55 np0000005197 sudo[14920]: pam_unix(sudo:session): session closed for user root Jul 15 13:02:55 np0000005197 sudo[14938]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-fsavpcpymjnihsriuqjtpjkaigizfejh ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120575.4092329-10068-97539840418309/AnsiballZ_apt.py' Jul 15 13:02:55 np0000005197 sudo[14938]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:02:59 np0000005197 sudo[14938]: pam_unix(sudo:session): session closed for user root Jul 15 13:02:59 np0000005197 sudo[15262]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-yleoiyjzfscehtvwvqftdudeiwebmstu ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120579.1553936-10078-122065374351317/AnsiballZ_apt.py' Jul 15 13:02:59 np0000005197 sudo[15262]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:03:08 np0000005197 sudo[15262]: pam_unix(sudo:session): session closed for user root Jul 15 13:03:09 np0000005197 sudo[15422]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-exfpgbtdfmpcqpwknlziqwwbbknuduln ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120589.0375762-10105-14358171956274/AnsiballZ_apt.py' Jul 15 13:03:09 np0000005197 sudo[15422]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:03:10 np0000005197 sudo[15422]: pam_unix(sudo:session): session closed for user root Jul 15 13:03:10 np0000005197 sudo[15738]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-fyytcahhbwewhpyziqrhrxqogzhaelyt ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120590.9232173-10115-439721763272/AnsiballZ_apt.py' Jul 15 13:03:10 np0000005197 sudo[15738]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:03:11 np0000005197 sudo[15738]: pam_unix(sudo:session): session closed for user root Jul 15 13:03:12 np0000005197 sudo[15762]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-ebusmxakaunidgkbkhzpuxvuqprbsaau ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120592.0071056-10125-63539123089982/AnsiballZ_apt.py' Jul 15 13:03:12 np0000005197 sudo[15762]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:03:29 np0000005197 kernel: Key type psk registered Jul 15 13:03:31 np0000005197 kernel: audit: type=1400 audit(1784120611.419:125): apparmor="STATUS" operation="profile_load" profile="unconfined" name="/usr/sbin/chronyd" pid=17360 comm="apparmor_parser" Jul 15 13:03:35 np0000005197 sudo[15762]: pam_unix(sudo:session): session closed for user root Jul 15 13:03:35 np0000005197 sudo[17624]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-ykbndsetciehdbtrowvkjiksjjmfjkzz ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120615.8562775-10134-12556610971334/AnsiballZ_stat.py' Jul 15 13:03:35 np0000005197 sudo[17624]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:03:36 np0000005197 sudo[17624]: pam_unix(sudo:session): session closed for user root Jul 15 13:03:36 np0000005197 sudo[17635]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-zocnknrhmpecmledkgdufzvpgsetpayb ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120615.8562775-10134-12556610971334/AnsiballZ_copy.py' Jul 15 13:03:36 np0000005197 sudo[17635]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:03:36 np0000005197 sudo[17635]: pam_unix(sudo:session): session closed for user root Jul 15 13:03:36 np0000005197 sudo[17653]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-bwgyumcwaukkmeimyobiwsedxliihagz ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120616.5623684-10149-24863027343752/AnsiballZ_mount.py' Jul 15 13:03:36 np0000005197 sudo[17653]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:03:36 np0000005197 sudo[17653]: pam_unix(sudo:session): session closed for user root Jul 15 13:03:37 np0000005197 sudo[17672]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-hwgqkjxcbwsxdxetnuxzfwnijalzjrld ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120617.053872-10157-155192772495853/AnsiballZ_command.py' Jul 15 13:03:37 np0000005197 sudo[17672]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:03:37 np0000005197 sudo[17672]: pam_unix(sudo:session): session closed for user root Jul 15 13:03:37 np0000005197 sudo[17691]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-lwzonwxelcyhtieazaklyjwvsqyimzow ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120617.5812645-10165-48527385052530/AnsiballZ_lineinfile.py' Jul 15 13:03:37 np0000005197 sudo[17691]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:03:38 np0000005197 sudo[17691]: pam_unix(sudo:session): session closed for user root Jul 15 13:03:39 np0000005197 sudo[17756]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-cmbwmxrjuiztdzqnudipmocnxtvqisvu ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120619.1984303-10197-256295081694075/AnsiballZ_lineinfile.py' Jul 15 13:03:39 np0000005197 sudo[17756]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:03:39 np0000005197 sudo[17756]: pam_unix(sudo:session): session closed for user root Jul 15 13:03:43 np0000005197 sudo[18241]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-rttezhgajdrrgjtfkzehaaixfzmcfltx ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120622.7258806-10213-201143001824589/AnsiballZ_systemd.py' Jul 15 13:03:43 np0000005197 sudo[18241]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:03:43 np0000005197 sudo[18241]: pam_unix(sudo:session): session closed for user root Jul 15 13:03:45 np0000005197 sudo[18280]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-uhqrdnqlpuzjroweqtmkatauvcobrgrr ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120625.697492-10234-211319056077018/AnsiballZ_lineinfile.py' Jul 15 13:03:45 np0000005197 sudo[18280]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:03:45 np0000005197 sudo[18280]: pam_unix(sudo:session): session closed for user root Jul 15 13:03:46 np0000005197 sudo[18298]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-ylcorregxkngzoaptlclqnccuvbsjncl ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120626.0494652-10234-173341082418383/AnsiballZ_lineinfile.py' Jul 15 13:03:46 np0000005197 sudo[18298]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:03:46 np0000005197 sudo[18298]: pam_unix(sudo:session): session closed for user root Jul 15 13:03:46 np0000005197 sudo[18316]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-typpphqrldtodpxfetkcvzvgbtgzoujr ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120626.4317515-10249-103576344840758/AnsiballZ_systemd.py' Jul 15 13:03:46 np0000005197 sudo[18316]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:03:47 np0000005197 sudo[18316]: pam_unix(sudo:session): session closed for user root Jul 15 13:03:47 np0000005197 sudo[18384]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-dxqprygtcrpmlsgmdyrjdovadcgagiyo ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120627.2189937-10249-271033183223460/AnsiballZ_systemd.py' Jul 15 13:03:47 np0000005197 sudo[18384]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:03:47 np0000005197 sudo[18384]: pam_unix(sudo:session): session closed for user root Jul 15 13:03:47 np0000005197 sudo[18406]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-okpbynaeucfukjhjmhawmzxjtmnagipx ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120627.759495-10264-97524714985395/AnsiballZ_lineinfile.py' Jul 15 13:03:47 np0000005197 sudo[18406]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:03:48 np0000005197 sudo[18406]: pam_unix(sudo:session): session closed for user root Jul 15 13:03:48 np0000005197 sudo[18424]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-qeajnhhlnthqwkkhdhiukwuvwxhpzccs ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120628.1642377-10272-194175043636643/AnsiballZ_systemd.py' Jul 15 13:03:48 np0000005197 sudo[18424]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:03:48 np0000005197 sudo[18424]: pam_unix(sudo:session): session closed for user root Jul 15 13:03:50 np0000005197 sudo[18593]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-lqnpphvmneniswkrhuugtzwpecdcedji ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120630.2436628-10306-6768271882114/AnsiballZ_stat.py' Jul 15 13:03:50 np0000005197 sudo[18593]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:03:50 np0000005197 sudo[18593]: pam_unix(sudo:session): session closed for user root Jul 15 13:03:50 np0000005197 sudo[18604]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-yrxaepcrjhbemiehfitvsjqqarkdmycv ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120630.2436628-10306-6768271882114/AnsiballZ_copy.py' Jul 15 13:03:50 np0000005197 sudo[18604]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:03:50 np0000005197 sudo[18604]: pam_unix(sudo:session): session closed for user root Jul 15 13:03:51 np0000005197 sudo[18637]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-wnsbuqfanxtignehfqnhbjbdnmragbro ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120631.322922-10329-64769800834592/AnsiballZ_file.py' Jul 15 13:03:51 np0000005197 sudo[18637]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:03:51 np0000005197 sudo[18637]: pam_unix(sudo:session): session closed for user root Jul 15 13:03:51 np0000005197 sudo[18655]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-zlynsvgqgiqwnwminqpgianylkqrmppa ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120631.6571515-10329-164397896356953/AnsiballZ_file.py' Jul 15 13:03:51 np0000005197 sudo[18655]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:03:51 np0000005197 sudo[18655]: pam_unix(sudo:session): session closed for user root Jul 15 13:03:52 np0000005197 sudo[18673]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-pcaroesntaxjvsfbpoploxxtoqzdyvqg ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120631.9715824-10329-35987258817874/AnsiballZ_file.py' Jul 15 13:03:52 np0000005197 sudo[18673]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:03:52 np0000005197 sudo[18673]: pam_unix(sudo:session): session closed for user root Jul 15 13:03:52 np0000005197 sudo[18691]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-twozlnfeeuclmzpwggguzybltkpeuhkx ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120632.3050897-10329-130731398437592/AnsiballZ_file.py' Jul 15 13:03:52 np0000005197 sudo[18691]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:03:52 np0000005197 sudo[18691]: pam_unix(sudo:session): session closed for user root Jul 15 13:03:52 np0000005197 sudo[18709]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-oezriwzfsylvfoouvztsbamasakzffiz ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120632.6199129-10329-104843159584935/AnsiballZ_file.py' Jul 15 13:03:52 np0000005197 sudo[18709]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:03:52 np0000005197 sudo[18709]: pam_unix(sudo:session): session closed for user root Jul 15 13:03:53 np0000005197 sudo[18727]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-arekqjtemrctdpjpsbrlxwpobcrgfnun ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120633.2759762-10373-36988777019935/AnsiballZ_apt.py' Jul 15 13:03:53 np0000005197 sudo[18727]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:03:54 np0000005197 sudo[18727]: pam_unix(sudo:session): session closed for user root Jul 15 13:03:54 np0000005197 sudo[18751]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-zgjbmpguwkcncprnzndkopoqtfkpztwq ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120634.2513695-10381-31882890367013/AnsiballZ_apt.py' Jul 15 13:03:54 np0000005197 sudo[18751]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:03:55 np0000005197 sudo[18751]: pam_unix(sudo:session): session closed for user root Jul 15 13:03:56 np0000005197 sudo[18805]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-itpsphfhapyoyhekqxzdlrhnxsgecyuf ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120636.451073-10417-56142935840048/AnsiballZ_stat.py' Jul 15 13:03:56 np0000005197 sudo[18805]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:03:56 np0000005197 sudo[18805]: pam_unix(sudo:session): session closed for user root Jul 15 13:03:56 np0000005197 sudo[18816]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-yerhqqrarfloxahzfxdeovayolmjvhqk ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120636.451073-10417-56142935840048/AnsiballZ_copy.py' Jul 15 13:03:56 np0000005197 sudo[18816]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:03:57 np0000005197 sudo[18816]: pam_unix(sudo:session): session closed for user root Jul 15 13:03:57 np0000005197 sudo[18834]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-pctccaqaguhevuxcurvideftbcdkwzfn ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120637.1507068-10432-181310249075121/AnsiballZ_command.py' Jul 15 13:03:57 np0000005197 sudo[18834]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:03:58 np0000005197 sudo[18834]: pam_unix(sudo:session): session closed for user root Jul 15 13:03:58 np0000005197 sudo[18854]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-uajgxumfcrexdjepjqqevgqdtbumpnts ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120638.266029-10441-255472417872357/AnsiballZ_file.py' Jul 15 13:03:58 np0000005197 sudo[18854]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:03:58 np0000005197 sudo[18854]: pam_unix(sudo:session): session closed for user root Jul 15 13:03:59 np0000005197 sudo[18873]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-fxthaeezpggiuvuvdehzuxamzicrssky ; ANSIBLE_ASYNC_DIR=\'~/.ansible_async\' /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120639.0754743-10471-21292230801675/async_wrapper.py j165893488573 1000 false /home/ubuntu/.ansible/tmp/ansible-tmp-1784120639.0754743-10471-21292230801675/AnsiballZ_command.py /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120639.0754743-10471-21292230801675/AnsiballZ_command.py' Jul 15 13:03:59 np0000005197 sudo[18873]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:03:59 np0000005197 sudo[18873]: pam_unix(sudo:session): session closed for user root Jul 15 13:04:00 np0000005197 sudo[19060]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-rkmsuuphbemllhgovijvtogpyzoaimit ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120640.0941799-10497-251448379291517/AnsiballZ_async_status.py' Jul 15 13:04:00 np0000005197 sudo[19060]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:04:00 np0000005197 sudo[19060]: pam_unix(sudo:session): session closed for user root Jul 15 13:04:05 np0000005197 sudo[19587]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-jyhzhzqoqaemwlnbjirohewzrkwlzked ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120645.5606458-10497-116941443353445/AnsiballZ_async_status.py' Jul 15 13:04:05 np0000005197 sudo[19587]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:04:05 np0000005197 sudo[19587]: pam_unix(sudo:session): session closed for user root Jul 15 13:04:10 np0000005197 sudo[20061]: ubuntu : TTY=pts/1 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-pohorthbeejacqycasivtwgaklqdhihr ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120650.887327-10497-145811609682970/AnsiballZ_async_status.py' Jul 15 13:04:10 np0000005197 sudo[20061]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:04:11 np0000005197 sudo[20061]: pam_unix(sudo:session): session closed for user root Jul 15 13:04:16 np0000005197 sudo[20282]: ubuntu : TTY=pts/1 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-foyviwhizpdkplnyklobnueauftromhb ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120656.224982-10497-192627149717580/AnsiballZ_async_status.py' Jul 15 13:04:16 np0000005197 sudo[20282]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:04:16 np0000005197 sudo[20282]: pam_unix(sudo:session): session closed for user root Jul 15 13:04:21 np0000005197 sudo[21378]: ubuntu : TTY=pts/1 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-vglocrndkixoejoxureikygzeubebdga ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120661.5526736-10497-70188871662920/AnsiballZ_async_status.py' Jul 15 13:04:21 np0000005197 sudo[21378]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:04:21 np0000005197 sudo[21378]: pam_unix(sudo:session): session closed for user root Jul 15 13:04:26 np0000005197 sudo[25434]: ubuntu : TTY=pts/1 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-kwgbbasyuiktiwnsgarjeuaqfdstwlut ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120666.8783605-10497-128340387458899/AnsiballZ_async_status.py' Jul 15 13:04:26 np0000005197 sudo[25434]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:04:27 np0000005197 sudo[25434]: pam_unix(sudo:session): session closed for user root Jul 15 13:04:27 np0000005197 kernel: audit: type=1400 audit(1784120667.904:126): apparmor="STATUS" operation="profile_replace" info="same as current profile, skipping" profile="unconfined" name="rsyslogd" pid=25529 comm="apparmor_parser" Jul 15 13:04:32 np0000005197 sudo[28787]: ubuntu : TTY=pts/1 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-kxphlckhvcrnihynrujstgglybdluopm ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120672.1985428-10497-132715577090963/AnsiballZ_async_status.py' Jul 15 13:04:32 np0000005197 sudo[28787]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:04:32 np0000005197 sudo[28787]: pam_unix(sudo:session): session closed for user root Jul 15 13:04:37 np0000005197 sudo[33139]: ubuntu : TTY=pts/1 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-kztvsanlxxubizkwnaxbgjebdncqxusj ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120677.51538-10497-62725871126514/AnsiballZ_async_status.py' Jul 15 13:04:37 np0000005197 sudo[33139]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:04:37 np0000005197 sudo[33139]: pam_unix(sudo:session): session closed for user root Jul 15 13:04:42 np0000005197 sudo[33497]: ubuntu : TTY=pts/1 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-pmpojjpypzhvquktlsydvlsygyvvideu ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120682.8409076-10497-151416764202619/AnsiballZ_async_status.py' Jul 15 13:04:42 np0000005197 sudo[33497]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:04:43 np0000005197 sudo[33497]: pam_unix(sudo:session): session closed for user root Jul 15 13:04:47 np0000005197 kernel: audit: type=1400 audit(1784120687.496:127): apparmor="STATUS" operation="profile_replace" info="same as current profile, skipping" profile="unconfined" name="rsyslogd" pid=33762 comm="apparmor_parser" Jul 15 13:04:48 np0000005197 sudo[33783]: ubuntu : TTY=pts/1 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-aqatrzxdcacpvtcymekomxqwaubelpqb ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120688.1586013-10497-235963284790605/AnsiballZ_async_status.py' Jul 15 13:04:48 np0000005197 sudo[33783]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:04:48 np0000005197 sudo[33783]: pam_unix(sudo:session): session closed for user root Jul 15 13:04:53 np0000005197 kernel: audit: type=1400 audit(1784120693.283:128): apparmor="STATUS" operation="profile_replace" profile="unconfined" name="tcpdump" pid=33979 comm="apparmor_parser" Jul 15 13:04:53 np0000005197 sudo[34080]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-fekcggycqbzthwhaydxxqhuwbpwoyfdh ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120693.4791412-10497-267559474328486/AnsiballZ_async_status.py' Jul 15 13:04:53 np0000005197 sudo[34080]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:04:53 np0000005197 sudo[34080]: pam_unix(sudo:session): session closed for user root Jul 15 13:04:58 np0000005197 sudo[38011]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-xibuetkkkrdkwjhdliiqwqfeskfsftiv ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120698.8288372-10497-201146590502578/AnsiballZ_async_status.py' Jul 15 13:04:58 np0000005197 sudo[38011]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:04:59 np0000005197 sudo[38011]: pam_unix(sudo:session): session closed for user root Jul 15 13:05:04 np0000005197 sudo[41920]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-lhhabotkpplfcxqasgbcgdwyriziuspb ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120704.1815696-10497-162021627459154/AnsiballZ_async_status.py' Jul 15 13:05:04 np0000005197 sudo[41920]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:05:04 np0000005197 sudo[41920]: pam_unix(sudo:session): session closed for user root Jul 15 13:05:09 np0000005197 sudo[42141]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-rwprrjxcfjofjujtfoedvoivyulqaksp ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120709.5288563-10497-160846477143254/AnsiballZ_async_status.py' Jul 15 13:05:09 np0000005197 sudo[42141]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:05:09 np0000005197 sudo[42141]: pam_unix(sudo:session): session closed for user root Jul 15 13:05:09 np0000005197 sudo[42159]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-zsgtbnfcodyqtluxilwrrljhgjjaveij ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120709.8599002-10613-22140436114234/AnsiballZ_systemd.py' Jul 15 13:05:09 np0000005197 sudo[42159]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:05:10 np0000005197 kernel: audit: type=1400 audit(1784120710.347:129): apparmor="STATUS" operation="profile_replace" info="same as current profile, skipping" profile="unconfined" name="rsyslogd" pid=42173 comm="apparmor_parser" Jul 15 13:05:10 np0000005197 sudo[42159]: pam_unix(sudo:session): session closed for user root Jul 15 13:05:10 np0000005197 sudo[42193]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-xyvooqmwkyruoxovusdedhmkmxlrehzk ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120710.4887867-10621-89680823170909/AnsiballZ_command.py' Jul 15 13:05:10 np0000005197 sudo[42193]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:05:10 np0000005197 sudo[42193]: pam_unix(sudo:session): session closed for user root Jul 15 13:05:10 np0000005197 sudo[42212]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-qqdaydklaekdqftduneoyovezwehrohm ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120710.893167-10631-43946919054227/AnsiballZ_command.py' Jul 15 13:05:10 np0000005197 sudo[42212]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:05:11 np0000005197 sudo[42212]: pam_unix(sudo:session): session closed for user root Jul 15 13:05:11 np0000005197 sudo[42231]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-vegrcvhhmbivrantloqqzvxbafmxpfju ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120711.33996-10639-81950528909355/AnsiballZ_lineinfile.py' Jul 15 13:05:11 np0000005197 sudo[42231]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:05:11 np0000005197 sudo[42231]: pam_unix(sudo:session): session closed for user root Jul 15 13:05:11 np0000005197 sudo[42249]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-ifnrugylhctdqurddmyjwverszcquzmi ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120711.802581-10650-72642434175712/AnsiballZ_command.py' Jul 15 13:05:11 np0000005197 sudo[42249]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:05:12 np0000005197 sudo[42249]: pam_unix(sudo:session): session closed for user root Jul 15 13:05:12 np0000005197 sudo[42271]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-dwogkdalzvbdbfjizgvxqyngtmucuynu ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120712.2354789-10658-171081281195941/AnsiballZ_systemd.py' Jul 15 13:05:12 np0000005197 sudo[42271]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:05:12 np0000005197 sudo[42271]: pam_unix(sudo:session): session closed for user root Jul 15 13:05:12 np0000005197 sudo[42291]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-zgvuaveoroelnfzszucsfecxztkxfetk ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120712.8008707-10667-136764321394431/AnsiballZ_stat.py' Jul 15 13:05:12 np0000005197 sudo[42291]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:05:13 np0000005197 sudo[42291]: pam_unix(sudo:session): session closed for user root Jul 15 13:05:13 np0000005197 sudo[42302]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-zbjfbuuxgbdmqzretxwdhaminktoahiq ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120712.8008707-10667-136764321394431/AnsiballZ_copy.py' Jul 15 13:05:13 np0000005197 sudo[42302]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:05:13 np0000005197 sudo[42302]: pam_unix(sudo:session): session closed for user root Jul 15 13:05:13 np0000005197 sudo[42320]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-yoqmhplrxuoscwjhktxcjwqdintbhmqp ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120713.5105467-10683-155523345460638/AnsiballZ_file.py' Jul 15 13:05:13 np0000005197 sudo[42320]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:05:13 np0000005197 sudo[42320]: pam_unix(sudo:session): session closed for user root Jul 15 13:05:13 np0000005197 sudo[42338]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-pnwqafokxgxsvhtrmivdndxhyotshvml ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120713.873505-10691-245816902886326/AnsiballZ_get_url.py' Jul 15 13:05:13 np0000005197 sudo[42338]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:05:14 np0000005197 sudo[42338]: pam_unix(sudo:session): session closed for user root Jul 15 13:05:14 np0000005197 sudo[42356]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-bgetxfvoudvyqsjqsogvystnwjdruemu ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120714.3528638-10699-117740548240780/AnsiballZ_file.py' Jul 15 13:05:14 np0000005197 sudo[42356]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:05:14 np0000005197 sudo[42356]: pam_unix(sudo:session): session closed for user root Jul 15 13:05:14 np0000005197 sudo[42374]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-gmypmwkoipuvemcpwiwkhrhodvzpibdh ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120714.8638065-10711-54273288917405/AnsiballZ_stat.py' Jul 15 13:05:14 np0000005197 sudo[42374]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:05:15 np0000005197 sudo[42374]: pam_unix(sudo:session): session closed for user root Jul 15 13:05:15 np0000005197 sudo[42392]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-zfvajrszalvgyikvzvkgvwjwsyuduihh ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120715.2402654-10719-174050929562859/AnsiballZ_command.py' Jul 15 13:05:15 np0000005197 sudo[42392]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:05:16 np0000005197 sudo[42392]: pam_unix(sudo:session): session closed for user root Jul 15 13:05:16 np0000005197 sudo[42809]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-hierdfenlvgzjzzyqnfedyjjuimldzbh ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120716.244667-10731-192028389609559/AnsiballZ_command.py' Jul 15 13:05:16 np0000005197 sudo[42809]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:05:28 np0000005197 sudo[42809]: pam_unix(sudo:session): session closed for user root Jul 15 13:05:28 np0000005197 sudo[50729]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-sngxbadhjpqeqpoxbydimtqvwlmyacjk ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120728.2144532-10744-203335099659757/AnsiballZ_setup.py' Jul 15 13:05:28 np0000005197 sudo[50729]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:05:28 np0000005197 sudo[50729]: pam_unix(sudo:session): session closed for user root Jul 15 13:05:28 np0000005197 sudo[50767]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-hldyoyfzvjxxyhcgljherpjypmxsfexa ; cat /proc/sys/kernel/random/boot_id' Jul 15 13:05:28 np0000005197 sudo[50767]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:05:28 np0000005197 sudo[50767]: pam_unix(sudo:session): session closed for user root Jul 15 13:05:28 np0000005197 sudo[50775]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-rgknzfonrgrcqpblmltljziknngwijly ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120728.2144532-10744-203335099659757/AnsiballZ_find.py' Jul 15 13:05:28 np0000005197 sudo[50775]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:05:29 np0000005197 sudo[50775]: pam_unix(sudo:session): session closed for user root Jul 15 13:05:29 np0000005197 sudo[50780]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-lojikfauonngquynpmxwuumizznqrntx ; /sbin/shutdown -r 0 "Reboot initiated by Ansible"' Jul 15 13:05:29 np0000005197 sudo[50780]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:05:29 np0000005197 sudo[50780]: pam_unix(sudo:session): session closed for user root Jul 15 13:05:29 np0000005197 kernel: EXT4-fs (sda16): unmounting filesystem 7dc15ce9-d090-44d7-bb05-2a36d545a8e3. -- Boot de13127df5624ca0964c040af290f2dc -- Jul 15 13:05:38 np0000005197 kernel: Linux version 6.8.0-134-generic (buildd@lcy02-amd64-007) (x86_64-linux-gnu-gcc-13 (Ubuntu 13.3.0-6ubuntu2~24.04.1) 13.3.0, GNU ld (GNU Binutils for Ubuntu) 2.42) #134-Ubuntu SMP PREEMPT_DYNAMIC Fri Jun 26 18:43:11 UTC 2026 (Ubuntu 6.8.0-134.134-generic 6.8.12) Jul 15 13:05:38 np0000005197 kernel: Command line: BOOT_IMAGE=/vmlinuz-6.8.0-134-generic root=UUID=8515de1c-ba7e-467b-adde-6d9f8a8dbc1f ro systemd.legacy_systemd_cgroup_controller=1 swapaccount=1 video=vesafb:off i915.modeset=0 vga=normal nomodeset usbcore.autosuspend=-1 systemd.unified_cgroup_hierarchy=0 nofb libata.fua=1 amd_pstate=guided console=tty1 console=ttyS0 crashkernel=1024M Jul 15 13:05:38 np0000005197 kernel: KERNEL supported cpus: Jul 15 13:05:38 np0000005197 kernel: Intel GenuineIntel Jul 15 13:05:38 np0000005197 kernel: AMD AuthenticAMD Jul 15 13:05:38 np0000005197 kernel: Hygon HygonGenuine Jul 15 13:05:38 np0000005197 kernel: Centaur CentaurHauls Jul 15 13:05:38 np0000005197 kernel: zhaoxin Shanghai Jul 15 13:05:38 np0000005197 kernel: BIOS-provided physical RAM map: Jul 15 13:05:38 np0000005197 kernel: BIOS-e820: [mem 0x0000000000000000-0x000000000009fbff] usable Jul 15 13:05:38 np0000005197 kernel: BIOS-e820: [mem 0x000000000009fc00-0x000000000009ffff] reserved Jul 15 13:05:38 np0000005197 kernel: BIOS-e820: [mem 0x00000000000f0000-0x00000000000fffff] reserved Jul 15 13:05:38 np0000005197 kernel: BIOS-e820: [mem 0x0000000000100000-0x000000007ffdafff] usable Jul 15 13:05:38 np0000005197 kernel: BIOS-e820: [mem 0x000000007ffdb000-0x000000007fffffff] reserved Jul 15 13:05:38 np0000005197 kernel: BIOS-e820: [mem 0x00000000b0000000-0x00000000bfffffff] reserved Jul 15 13:05:38 np0000005197 kernel: BIOS-e820: [mem 0x00000000fed1c000-0x00000000fed1ffff] reserved Jul 15 13:05:38 np0000005197 kernel: BIOS-e820: [mem 0x00000000feffc000-0x00000000feffffff] reserved Jul 15 13:05:38 np0000005197 kernel: BIOS-e820: [mem 0x00000000fffc0000-0x00000000ffffffff] reserved Jul 15 13:05:38 np0000005197 kernel: BIOS-e820: [mem 0x0000000100000000-0x000000067fffffff] usable Jul 15 13:05:38 np0000005197 kernel: BIOS-e820: [mem 0x000000fd00000000-0x000000ffffffffff] reserved Jul 15 13:05:38 np0000005197 kernel: NX (Execute Disable) protection: active Jul 15 13:05:38 np0000005197 kernel: APIC: Static calls initialized Jul 15 13:05:38 np0000005197 kernel: SMBIOS 3.0.0 present. Jul 15 13:05:38 np0000005197 kernel: DMI: OpenStack Foundation OpenStack Nova, BIOS 1.16.3-debian-1.16.3-2 04/01/2014 Jul 15 13:05:38 np0000005197 kernel: Hypervisor detected: KVM Jul 15 13:05:38 np0000005197 kernel: kvm-clock: Using msrs 4b564d01 and 4b564d00 Jul 15 13:05:38 np0000005197 kernel: kvm-clock: using sched offset of 741077023391 cycles Jul 15 13:05:38 np0000005197 kernel: clocksource: kvm-clock: mask: 0xffffffffffffffff max_cycles: 0x1cd42e4dffb, max_idle_ns: 881590591483 ns Jul 15 13:05:38 np0000005197 kernel: tsc: Detected 2395.498 MHz processor Jul 15 13:05:38 np0000005197 kernel: e820: update [mem 0x00000000-0x00000fff] usable ==> reserved Jul 15 13:05:38 np0000005197 kernel: e820: remove [mem 0x000a0000-0x000fffff] usable Jul 15 13:05:38 np0000005197 kernel: last_pfn = 0x680000 max_arch_pfn = 0x400000000 Jul 15 13:05:38 np0000005197 kernel: MTRR map: 4 entries (3 fixed + 1 variable; max 19), built from 8 variable MTRRs Jul 15 13:05:38 np0000005197 kernel: x86/PAT: Configuration [0-7]: WB WC UC- UC WB WP UC- WT Jul 15 13:05:38 np0000005197 kernel: last_pfn = 0x7ffdb max_arch_pfn = 0x400000000 Jul 15 13:05:38 np0000005197 kernel: found SMP MP-table at [mem 0x000f5380-0x000f538f] Jul 15 13:05:38 np0000005197 kernel: Using GB pages for direct mapping Jul 15 13:05:38 np0000005197 kernel: RAMDISK: [mem 0x344b5000-0x36251fff] Jul 15 13:05:38 np0000005197 kernel: ACPI: Early table checksum verification disabled Jul 15 13:05:38 np0000005197 kernel: ACPI: RSDP 0x00000000000F5340 000014 (v00 BOCHS ) Jul 15 13:05:38 np0000005197 kernel: ACPI: RSDT 0x000000007FFE3A81 000034 (v01 BOCHS BXPC 00000001 BXPC 00000001) Jul 15 13:05:38 np0000005197 kernel: ACPI: FACP 0x000000007FFE3859 0000F4 (v03 BOCHS BXPC 00000001 BXPC 00000001) Jul 15 13:05:38 np0000005197 kernel: ACPI: DSDT 0x000000007FFDFB00 003D59 (v01 BOCHS BXPC 00000001 BXPC 00000001) Jul 15 13:05:38 np0000005197 kernel: ACPI: FACS 0x000000007FFDFAC0 000040 Jul 15 13:05:38 np0000005197 kernel: ACPI: APIC 0x000000007FFE394D 0000D0 (v03 BOCHS BXPC 00000001 BXPC 00000001) Jul 15 13:05:38 np0000005197 kernel: ACPI: MCFG 0x000000007FFE3A1D 00003C (v01 BOCHS BXPC 00000001 BXPC 00000001) Jul 15 13:05:38 np0000005197 kernel: ACPI: WAET 0x000000007FFE3A59 000028 (v01 BOCHS BXPC 00000001 BXPC 00000001) Jul 15 13:05:38 np0000005197 kernel: ACPI: Reserving FACP table memory at [mem 0x7ffe3859-0x7ffe394c] Jul 15 13:05:38 np0000005197 kernel: ACPI: Reserving DSDT table memory at [mem 0x7ffdfb00-0x7ffe3858] Jul 15 13:05:38 np0000005197 kernel: ACPI: Reserving FACS table memory at [mem 0x7ffdfac0-0x7ffdfaff] Jul 15 13:05:38 np0000005197 kernel: ACPI: Reserving APIC table memory at [mem 0x7ffe394d-0x7ffe3a1c] Jul 15 13:05:38 np0000005197 kernel: ACPI: Reserving MCFG table memory at [mem 0x7ffe3a1d-0x7ffe3a58] Jul 15 13:05:38 np0000005197 kernel: ACPI: Reserving WAET table memory at [mem 0x7ffe3a59-0x7ffe3a80] Jul 15 13:05:38 np0000005197 kernel: No NUMA configuration found Jul 15 13:05:38 np0000005197 kernel: Faking a node at [mem 0x0000000000000000-0x000000067fffffff] Jul 15 13:05:38 np0000005197 kernel: NODE_DATA(0) allocated [mem 0x67ffd5000-0x67fffffff] Jul 15 13:05:38 np0000005197 kernel: crashkernel reserved: 0x000000003f000000 - 0x000000007f000000 (1024 MB) Jul 15 13:05:38 np0000005197 kernel: Zone ranges: Jul 15 13:05:38 np0000005197 kernel: DMA [mem 0x0000000000001000-0x0000000000ffffff] Jul 15 13:05:38 np0000005197 kernel: DMA32 [mem 0x0000000001000000-0x00000000ffffffff] Jul 15 13:05:38 np0000005197 kernel: Normal [mem 0x0000000100000000-0x000000067fffffff] Jul 15 13:05:38 np0000005197 kernel: Device empty Jul 15 13:05:38 np0000005197 kernel: Movable zone start for each node Jul 15 13:05:38 np0000005197 kernel: Early memory node ranges Jul 15 13:05:38 np0000005197 kernel: node 0: [mem 0x0000000000001000-0x000000000009efff] Jul 15 13:05:38 np0000005197 kernel: node 0: [mem 0x0000000000100000-0x000000007ffdafff] Jul 15 13:05:38 np0000005197 kernel: node 0: [mem 0x0000000100000000-0x000000067fffffff] Jul 15 13:05:38 np0000005197 kernel: Initmem setup node 0 [mem 0x0000000000001000-0x000000067fffffff] Jul 15 13:05:38 np0000005197 kernel: On node 0, zone DMA: 1 pages in unavailable ranges Jul 15 13:05:38 np0000005197 kernel: On node 0, zone DMA: 97 pages in unavailable ranges Jul 15 13:05:38 np0000005197 kernel: On node 0, zone Normal: 37 pages in unavailable ranges Jul 15 13:05:38 np0000005197 kernel: ACPI: PM-Timer IO Port: 0x608 Jul 15 13:05:38 np0000005197 kernel: ACPI: LAPIC_NMI (acpi_id[0xff] dfl dfl lint[0x1]) Jul 15 13:05:38 np0000005197 kernel: IOAPIC[0]: apic_id 0, version 17, address 0xfec00000, GSI 0-23 Jul 15 13:05:38 np0000005197 kernel: ACPI: INT_SRC_OVR (bus 0 bus_irq 0 global_irq 2 dfl dfl) Jul 15 13:05:38 np0000005197 kernel: ACPI: INT_SRC_OVR (bus 0 bus_irq 5 global_irq 5 high level) Jul 15 13:05:38 np0000005197 kernel: ACPI: INT_SRC_OVR (bus 0 bus_irq 9 global_irq 9 high level) Jul 15 13:05:38 np0000005197 kernel: ACPI: INT_SRC_OVR (bus 0 bus_irq 10 global_irq 10 high level) Jul 15 13:05:38 np0000005197 kernel: ACPI: INT_SRC_OVR (bus 0 bus_irq 11 global_irq 11 high level) Jul 15 13:05:38 np0000005197 kernel: ACPI: Using ACPI (MADT) for SMP configuration information Jul 15 13:05:38 np0000005197 kernel: TSC deadline timer available Jul 15 13:05:38 np0000005197 kernel: smpboot: Allowing 12 CPUs, 0 hotplug CPUs Jul 15 13:05:38 np0000005197 kernel: kvm-guest: APIC: eoi() replaced with kvm_guest_apic_eoi_write() Jul 15 13:05:38 np0000005197 kernel: PM: hibernation: Registered nosave memory: [mem 0x00000000-0x00000fff] Jul 15 13:05:38 np0000005197 kernel: PM: hibernation: Registered nosave memory: [mem 0x0009f000-0x000fffff] Jul 15 13:05:38 np0000005197 kernel: PM: hibernation: Registered nosave memory: [mem 0x7ffdb000-0xffffffff] Jul 15 13:05:38 np0000005197 kernel: [mem 0xc0000000-0xfed1bfff] available for PCI devices Jul 15 13:05:38 np0000005197 kernel: Booting paravirtualized kernel on KVM Jul 15 13:05:38 np0000005197 kernel: clocksource: refined-jiffies: mask: 0xffffffff max_cycles: 0xffffffff, max_idle_ns: 1910969940391419 ns Jul 15 13:05:38 np0000005197 kernel: setup_percpu: NR_CPUS:8192 nr_cpumask_bits:12 nr_cpu_ids:12 nr_node_ids:1 Jul 15 13:05:38 np0000005197 kernel: percpu: Embedded 86 pages/cpu s229376 r8192 d114688 u524288 Jul 15 13:05:38 np0000005197 kernel: pcpu-alloc: s229376 r8192 d114688 u524288 alloc=1*2097152 Jul 15 13:05:38 np0000005197 kernel: pcpu-alloc: [0] 00 01 02 03 [0] 04 05 06 07 Jul 15 13:05:38 np0000005197 kernel: pcpu-alloc: [0] 08 09 10 11 Jul 15 13:05:38 np0000005197 kernel: kvm-guest: PV spinlocks disabled, no host support Jul 15 13:05:38 np0000005197 kernel: Kernel command line: BOOT_IMAGE=/vmlinuz-6.8.0-134-generic root=UUID=8515de1c-ba7e-467b-adde-6d9f8a8dbc1f ro systemd.legacy_systemd_cgroup_controller=1 swapaccount=1 video=vesafb:off i915.modeset=0 vga=normal nomodeset usbcore.autosuspend=-1 systemd.unified_cgroup_hierarchy=0 nofb libata.fua=1 amd_pstate=guided console=tty1 console=ttyS0 crashkernel=1024M Jul 15 13:05:38 np0000005197 kernel: Booted with the nomodeset parameter. Only the system framebuffer will be available Jul 15 13:05:38 np0000005197 kernel: Unknown kernel command line parameters "nofb vga=normal", will be passed to user space. Jul 15 13:05:38 np0000005197 kernel: random: crng init done Jul 15 13:05:38 np0000005197 kernel: Dentry cache hash table entries: 4194304 (order: 13, 33554432 bytes, linear) Jul 15 13:05:38 np0000005197 kernel: Inode-cache hash table entries: 2097152 (order: 12, 16777216 bytes, linear) Jul 15 13:05:38 np0000005197 kernel: Fallback order for Node 0: 0 Jul 15 13:05:38 np0000005197 kernel: Built 1 zonelists, mobility grouping on. Total pages: 6192859 Jul 15 13:05:38 np0000005197 kernel: Policy zone: Normal Jul 15 13:05:38 np0000005197 kernel: mem auto-init: stack:all(zero), heap alloc:on, heap free:off Jul 15 13:05:38 np0000005197 kernel: software IO TLB: area num 16. Jul 15 13:05:38 np0000005197 kernel: Memory: 23519052K/25165284K available (22528K kernel code, 4439K rwdata, 14420K rodata, 4924K init, 4788K bss, 1645972K reserved, 0K cma-reserved) Jul 15 13:05:38 np0000005197 kernel: SLUB: HWalign=64, Order=0-3, MinObjects=0, CPUs=12, Nodes=1 Jul 15 13:05:38 np0000005197 kernel: ftrace: allocating 58301 entries in 228 pages Jul 15 13:05:38 np0000005197 kernel: ftrace: allocated 228 pages with 4 groups Jul 15 13:05:38 np0000005197 kernel: Dynamic Preempt: voluntary Jul 15 13:05:38 np0000005197 kernel: rcu: Preemptible hierarchical RCU implementation. Jul 15 13:05:38 np0000005197 kernel: rcu: RCU restricting CPUs from NR_CPUS=8192 to nr_cpu_ids=12. Jul 15 13:05:38 np0000005197 kernel: Trampoline variant of Tasks RCU enabled. Jul 15 13:05:38 np0000005197 kernel: Rude variant of Tasks RCU enabled. Jul 15 13:05:38 np0000005197 kernel: Tracing variant of Tasks RCU enabled. Jul 15 13:05:38 np0000005197 kernel: rcu: RCU calculated value of scheduler-enlistment delay is 100 jiffies. Jul 15 13:05:38 np0000005197 kernel: rcu: Adjusting geometry for rcu_fanout_leaf=16, nr_cpu_ids=12 Jul 15 13:05:38 np0000005197 kernel: RCU Tasks: Setting shift to 4 and lim to 1 rcu_task_cb_adjust=1 rcu_task_cpu_ids=12. Jul 15 13:05:38 np0000005197 kernel: RCU Tasks Rude: Setting shift to 4 and lim to 1 rcu_task_cb_adjust=1 rcu_task_cpu_ids=12. Jul 15 13:05:38 np0000005197 kernel: RCU Tasks Trace: Setting shift to 4 and lim to 1 rcu_task_cb_adjust=1 rcu_task_cpu_ids=12. Jul 15 13:05:38 np0000005197 kernel: NR_IRQS: 524544, nr_irqs: 520, preallocated irqs: 16 Jul 15 13:05:38 np0000005197 kernel: rcu: srcu_init: Setting srcu_struct sizes based on contention. Jul 15 13:05:38 np0000005197 kernel: Console: colour VGA+ 80x25 Jul 15 13:05:38 np0000005197 kernel: printk: legacy console [tty1] enabled Jul 15 13:05:38 np0000005197 kernel: printk: legacy console [ttyS0] enabled Jul 15 13:05:38 np0000005197 kernel: ACPI: Core revision 20230628 Jul 15 13:05:38 np0000005197 kernel: APIC: Switch to symmetric I/O mode setup Jul 15 13:05:38 np0000005197 kernel: x2apic enabled Jul 15 13:05:38 np0000005197 kernel: APIC: Switched APIC routing to: physical x2apic Jul 15 13:05:38 np0000005197 kernel: tsc: Marking TSC unstable due to TSCs unsynchronized Jul 15 13:05:38 np0000005197 kernel: Calibrating delay loop (skipped) preset value.. 4790.99 BogoMIPS (lpj=2395498) Jul 15 13:05:38 np0000005197 kernel: x86/cpu: User Mode Instruction Prevention (UMIP) activated Jul 15 13:05:38 np0000005197 kernel: Last level iTLB entries: 4KB 512, 2MB 255, 4MB 127 Jul 15 13:05:38 np0000005197 kernel: Last level dTLB entries: 4KB 512, 2MB 255, 4MB 127, 1GB 0 Jul 15 13:05:38 np0000005197 kernel: Spectre V1 : Mitigation: usercopy/swapgs barriers and __user pointer sanitization Jul 15 13:05:38 np0000005197 kernel: Spectre V2 : Mitigation: Retpolines Jul 15 13:05:38 np0000005197 kernel: Spectre V2 : Spectre v2 / SpectreRSB: Filling RSB on context switch and VMEXIT Jul 15 13:05:38 np0000005197 kernel: Spectre V2 : Enabling Restricted Speculation for firmware calls Jul 15 13:05:38 np0000005197 kernel: Spectre V2 : mitigation: Enabling conditional Indirect Branch Prediction Barrier Jul 15 13:05:38 np0000005197 kernel: Speculative Store Bypass: Mitigation: Speculative Store Bypass disabled via prctl Jul 15 13:05:38 np0000005197 kernel: Speculative Return Stack Overflow: IBPB-extending microcode not applied! Jul 15 13:05:38 np0000005197 kernel: Speculative Return Stack Overflow: WARNING: See https://kernel.org/doc/html/latest/admin-guide/hw-vuln/srso.html for mitigation options. Jul 15 13:05:38 np0000005197 kernel: active return thunk: srso_alias_return_thunk Jul 15 13:05:38 np0000005197 kernel: Speculative Return Stack Overflow: Vulnerable: Safe RET, no microcode Jul 15 13:05:38 np0000005197 kernel: Transient Scheduler Attacks: Forcing mitigation on in a VM Jul 15 13:05:38 np0000005197 kernel: Transient Scheduler Attacks: Vulnerable: Clear CPU buffers attempted, no microcode Jul 15 13:05:38 np0000005197 kernel: x86/fpu: Supporting XSAVE feature 0x001: 'x87 floating point registers' Jul 15 13:05:38 np0000005197 kernel: x86/fpu: Supporting XSAVE feature 0x002: 'SSE registers' Jul 15 13:05:38 np0000005197 kernel: x86/fpu: Supporting XSAVE feature 0x004: 'AVX registers' Jul 15 13:05:38 np0000005197 kernel: x86/fpu: Supporting XSAVE feature 0x200: 'Protection Keys User registers' Jul 15 13:05:38 np0000005197 kernel: x86/fpu: xstate_offset[2]: 576, xstate_sizes[2]: 256 Jul 15 13:05:38 np0000005197 kernel: x86/fpu: xstate_offset[9]: 832, xstate_sizes[9]: 8 Jul 15 13:05:38 np0000005197 kernel: x86/fpu: Enabled xstate features 0x207, context size is 840 bytes, using 'compacted' format. Jul 15 13:05:38 np0000005197 kernel: Freeing SMP alternatives memory: 48K Jul 15 13:05:38 np0000005197 kernel: pid_max: default: 32768 minimum: 301 Jul 15 13:05:38 np0000005197 kernel: LSM: initializing lsm=lockdown,capability,landlock,yama,apparmor,integrity Jul 15 13:05:38 np0000005197 kernel: landlock: Up and running. Jul 15 13:05:38 np0000005197 kernel: Yama: becoming mindful. Jul 15 13:05:38 np0000005197 kernel: AppArmor: AppArmor initialized Jul 15 13:05:38 np0000005197 kernel: Mount-cache hash table entries: 65536 (order: 7, 524288 bytes, linear) Jul 15 13:05:38 np0000005197 kernel: Mountpoint-cache hash table entries: 65536 (order: 7, 524288 bytes, linear) Jul 15 13:05:38 np0000005197 kernel: smpboot: CPU0: AMD EPYC-Milan Processor (family: 0x19, model: 0x1, stepping: 0x1) Jul 15 13:05:38 np0000005197 kernel: Performance Events: Fam17h+ core perfctr, AMD PMU driver. Jul 15 13:05:38 np0000005197 kernel: ... version: 0 Jul 15 13:05:38 np0000005197 kernel: ... bit width: 48 Jul 15 13:05:38 np0000005197 kernel: ... generic registers: 6 Jul 15 13:05:38 np0000005197 kernel: ... value mask: 0000ffffffffffff Jul 15 13:05:38 np0000005197 kernel: ... max period: 00007fffffffffff Jul 15 13:05:38 np0000005197 kernel: ... fixed-purpose events: 0 Jul 15 13:05:38 np0000005197 kernel: ... event mask: 000000000000003f Jul 15 13:05:38 np0000005197 kernel: signal: max sigframe size: 3376 Jul 15 13:05:38 np0000005197 kernel: rcu: Hierarchical SRCU implementation. Jul 15 13:05:38 np0000005197 kernel: rcu: Max phase no-delay instances is 400. Jul 15 13:05:38 np0000005197 kernel: smp: Bringing up secondary CPUs ... Jul 15 13:05:38 np0000005197 kernel: smpboot: x86: Booting SMP configuration: Jul 15 13:05:38 np0000005197 kernel: .... node #0, CPUs: #1 #2 #3 #4 #5 #6 #7 #8 #9 #10 #11 Jul 15 13:05:38 np0000005197 kernel: smp: Brought up 1 node, 12 CPUs Jul 15 13:05:38 np0000005197 kernel: smpboot: Max logical packages: 12 Jul 15 13:05:38 np0000005197 kernel: smpboot: Total of 12 processors activated (57491.95 BogoMIPS) Jul 15 13:05:38 np0000005197 kernel: devtmpfs: initialized Jul 15 13:05:38 np0000005197 kernel: x86/mm: Memory block size: 128MB Jul 15 13:05:38 np0000005197 kernel: clocksource: jiffies: mask: 0xffffffff max_cycles: 0xffffffff, max_idle_ns: 1911260446275000 ns Jul 15 13:05:38 np0000005197 kernel: futex hash table entries: 4096 (order: 6, 262144 bytes, linear) Jul 15 13:05:38 np0000005197 kernel: pinctrl core: initialized pinctrl subsystem Jul 15 13:05:38 np0000005197 kernel: PM: RTC time: 13:05:35, date: 2026-07-15 Jul 15 13:05:38 np0000005197 kernel: NET: Registered PF_NETLINK/PF_ROUTE protocol family Jul 15 13:05:38 np0000005197 kernel: DMA: preallocated 4096 KiB GFP_KERNEL pool for atomic allocations Jul 15 13:05:38 np0000005197 kernel: DMA: preallocated 4096 KiB GFP_KERNEL|GFP_DMA pool for atomic allocations Jul 15 13:05:38 np0000005197 kernel: DMA: preallocated 4096 KiB GFP_KERNEL|GFP_DMA32 pool for atomic allocations Jul 15 13:05:38 np0000005197 kernel: audit: initializing netlink subsys (disabled) Jul 15 13:05:38 np0000005197 kernel: audit: type=2000 audit(1784120735.287:1): state=initialized audit_enabled=0 res=1 Jul 15 13:05:38 np0000005197 kernel: thermal_sys: Registered thermal governor 'fair_share' Jul 15 13:05:38 np0000005197 kernel: thermal_sys: Registered thermal governor 'bang_bang' Jul 15 13:05:38 np0000005197 kernel: thermal_sys: Registered thermal governor 'step_wise' Jul 15 13:05:38 np0000005197 kernel: thermal_sys: Registered thermal governor 'user_space' Jul 15 13:05:38 np0000005197 kernel: thermal_sys: Registered thermal governor 'power_allocator' Jul 15 13:05:38 np0000005197 kernel: cpuidle: using governor ladder Jul 15 13:05:38 np0000005197 kernel: cpuidle: using governor menu Jul 15 13:05:38 np0000005197 kernel: acpiphp: ACPI Hot Plug PCI Controller Driver version: 0.5 Jul 15 13:05:38 np0000005197 kernel: PCI: ECAM [mem 0xb0000000-0xbfffffff] (base 0xb0000000) for domain 0000 [bus 00-ff] Jul 15 13:05:38 np0000005197 kernel: PCI: ECAM [mem 0xb0000000-0xbfffffff] reserved as E820 entry Jul 15 13:05:38 np0000005197 kernel: PCI: Using configuration type 1 for base access Jul 15 13:05:38 np0000005197 kernel: kprobes: kprobe jump-optimization is enabled. All kprobes are optimized if possible. Jul 15 13:05:38 np0000005197 kernel: HugeTLB: registered 1.00 GiB page size, pre-allocated 0 pages Jul 15 13:05:38 np0000005197 kernel: HugeTLB: 16380 KiB vmemmap can be freed for a 1.00 GiB page Jul 15 13:05:38 np0000005197 kernel: HugeTLB: registered 2.00 MiB page size, pre-allocated 0 pages Jul 15 13:05:38 np0000005197 kernel: HugeTLB: 28 KiB vmemmap can be freed for a 2.00 MiB page Jul 15 13:05:38 np0000005197 kernel: ACPI: Added _OSI(Module Device) Jul 15 13:05:38 np0000005197 kernel: ACPI: Added _OSI(Processor Device) Jul 15 13:05:38 np0000005197 kernel: ACPI: Added _OSI(Processor Aggregator Device) Jul 15 13:05:38 np0000005197 kernel: ACPI: 1 ACPI AML tables successfully acquired and loaded Jul 15 13:05:38 np0000005197 kernel: ACPI: _OSC evaluation for CPUs failed, trying _PDC Jul 15 13:05:38 np0000005197 kernel: ACPI: Interpreter enabled Jul 15 13:05:38 np0000005197 kernel: ACPI: PM: (supports S0 S3 S4 S5) Jul 15 13:05:38 np0000005197 kernel: ACPI: Using IOAPIC for interrupt routing Jul 15 13:05:38 np0000005197 kernel: PCI: Using host bridge windows from ACPI; if necessary, use "pci=nocrs" and report a bug Jul 15 13:05:38 np0000005197 kernel: PCI: Using E820 reservations for host bridge windows Jul 15 13:05:38 np0000005197 kernel: ACPI: Enabled 2 GPEs in block 00 to 3F Jul 15 13:05:38 np0000005197 kernel: ACPI: PCI Root Bridge [PCI0] (domain 0000 [bus 00-ff]) Jul 15 13:05:38 np0000005197 kernel: acpi PNP0A08:00: _OSC: OS supports [ExtendedConfig ASPM ClockPM Segments MSI EDR HPX-Type3] Jul 15 13:05:38 np0000005197 kernel: acpi PNP0A08:00: _OSC: platform does not support [PCIeHotplug LTR DPC] Jul 15 13:05:38 np0000005197 kernel: acpi PNP0A08:00: _OSC: OS now controls [SHPCHotplug PME AER PCIeCapability] Jul 15 13:05:38 np0000005197 kernel: PCI host bridge to bus 0000:00 Jul 15 13:05:38 np0000005197 kernel: pci_bus 0000:00: root bus resource [io 0x0000-0x0cf7 window] Jul 15 13:05:38 np0000005197 kernel: pci_bus 0000:00: root bus resource [io 0x0d00-0xffff window] Jul 15 13:05:38 np0000005197 kernel: pci_bus 0000:00: root bus resource [mem 0x000a0000-0x000bffff window] Jul 15 13:05:38 np0000005197 kernel: pci_bus 0000:00: root bus resource [mem 0x80000000-0xafffffff window] Jul 15 13:05:38 np0000005197 kernel: pci_bus 0000:00: root bus resource [mem 0xc0000000-0xfebfffff window] Jul 15 13:05:38 np0000005197 kernel: pci_bus 0000:00: root bus resource [mem 0xc000000000-0xc7ffffffff window] Jul 15 13:05:38 np0000005197 kernel: pci_bus 0000:00: root bus resource [bus 00-ff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:00.0: [8086:29c0] type 00 class 0x060000 conventional PCI endpoint Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:01.0: [1af4:1050] type 00 class 0x030000 conventional PCI endpoint Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:01.0: BAR 0 [mem 0xfb800000-0xfbffffff pref] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:01.0: BAR 2 [mem 0xc220000000-0xc220003fff 64bit pref] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:01.0: BAR 4 [mem 0xfea10000-0xfea10fff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:01.0: ROM [mem 0xfea00000-0xfea0ffff pref] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:01.0: Video device with shadowed ROM at [mem 0x000c0000-0x000dffff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.0: [1b36:000c] type 01 class 0x060400 PCIe Root Port Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.0: BAR 0 [mem 0xfea11000-0xfea11fff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.0: PCI bridge to [bus 01-02] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.0: bridge window [io 0xc000-0xcfff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.0: bridge window [mem 0xfc600000-0xfc9fffff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.0: bridge window [mem 0xc200000000-0xc21fffffff 64bit pref] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.1: [1b36:000c] type 01 class 0x060400 PCIe Root Port Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.1: BAR 0 [mem 0xfea12000-0xfea12fff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.1: PCI bridge to [bus 03] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.1: bridge window [mem 0xfe800000-0xfe9fffff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.1: bridge window [mem 0xc1e0000000-0xc1ffffffff 64bit pref] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.2: [1b36:000c] type 01 class 0x060400 PCIe Root Port Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.2: BAR 0 [mem 0xfea13000-0xfea13fff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.2: PCI bridge to [bus 04] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.2: bridge window [mem 0xfe600000-0xfe7fffff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.2: bridge window [mem 0xc1c0000000-0xc1dfffffff 64bit pref] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.3: [1b36:000c] type 01 class 0x060400 PCIe Root Port Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.3: BAR 0 [mem 0xfea14000-0xfea14fff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.3: PCI bridge to [bus 05] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.3: bridge window [mem 0xfe400000-0xfe5fffff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.3: bridge window [mem 0xc1a0000000-0xc1bfffffff 64bit pref] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.4: [1b36:000c] type 01 class 0x060400 PCIe Root Port Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.4: BAR 0 [mem 0xfea15000-0xfea15fff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.4: PCI bridge to [bus 06] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.4: bridge window [mem 0xfe200000-0xfe3fffff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.4: bridge window [mem 0xc180000000-0xc19fffffff 64bit pref] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.5: [1b36:000c] type 01 class 0x060400 PCIe Root Port Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.5: BAR 0 [mem 0xfea16000-0xfea16fff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.5: PCI bridge to [bus 07] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.5: bridge window [mem 0xfe000000-0xfe1fffff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.5: bridge window [mem 0xc160000000-0xc17fffffff 64bit pref] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.6: [1b36:000c] type 01 class 0x060400 PCIe Root Port Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.6: BAR 0 [mem 0xfea17000-0xfea17fff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.6: PCI bridge to [bus 08] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.6: bridge window [mem 0xfde00000-0xfdffffff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.6: bridge window [mem 0xc140000000-0xc15fffffff 64bit pref] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.7: [1b36:000c] type 01 class 0x060400 PCIe Root Port Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.7: BAR 0 [mem 0xfea18000-0xfea18fff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.7: PCI bridge to [bus 09] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.7: bridge window [mem 0xfdc00000-0xfddfffff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.7: bridge window [mem 0xc120000000-0xc13fffffff 64bit pref] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.0: [1b36:000c] type 01 class 0x060400 PCIe Root Port Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.0: BAR 0 [mem 0xfea19000-0xfea19fff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.0: PCI bridge to [bus 0a] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.0: bridge window [mem 0xfda00000-0xfdbfffff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.0: bridge window [mem 0xc100000000-0xc11fffffff 64bit pref] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.1: [1b36:000c] type 01 class 0x060400 PCIe Root Port Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.1: BAR 0 [mem 0xfea1a000-0xfea1afff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.1: PCI bridge to [bus 0b] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.1: bridge window [mem 0xfd800000-0xfd9fffff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.1: bridge window [mem 0xc0e0000000-0xc0ffffffff 64bit pref] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.2: [1b36:000c] type 01 class 0x060400 PCIe Root Port Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.2: BAR 0 [mem 0xfea1b000-0xfea1bfff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.2: PCI bridge to [bus 0c] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.2: bridge window [mem 0xfd600000-0xfd7fffff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.2: bridge window [mem 0xc0c0000000-0xc0dfffffff 64bit pref] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.3: [1b36:000c] type 01 class 0x060400 PCIe Root Port Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.3: BAR 0 [mem 0xfea1c000-0xfea1cfff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.3: PCI bridge to [bus 0d] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.3: bridge window [mem 0xfd400000-0xfd5fffff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.3: bridge window [mem 0xc0a0000000-0xc0bfffffff 64bit pref] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.4: [1b36:000c] type 01 class 0x060400 PCIe Root Port Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.4: BAR 0 [mem 0xfea1d000-0xfea1dfff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.4: PCI bridge to [bus 0e] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.4: bridge window [mem 0xfd200000-0xfd3fffff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.4: bridge window [mem 0xc080000000-0xc09fffffff 64bit pref] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.5: [1b36:000c] type 01 class 0x060400 PCIe Root Port Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.5: BAR 0 [mem 0xfea1e000-0xfea1efff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.5: PCI bridge to [bus 0f] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.5: bridge window [mem 0xfd000000-0xfd1fffff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.5: bridge window [mem 0xc060000000-0xc07fffffff 64bit pref] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.6: [1b36:000c] type 01 class 0x060400 PCIe Root Port Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.6: BAR 0 [mem 0xfea1f000-0xfea1ffff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.6: PCI bridge to [bus 10] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.6: bridge window [mem 0xfce00000-0xfcffffff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.6: bridge window [mem 0xc040000000-0xc05fffffff 64bit pref] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.7: [1b36:000c] type 01 class 0x060400 PCIe Root Port Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.7: BAR 0 [mem 0xfea20000-0xfea20fff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.7: PCI bridge to [bus 11] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.7: bridge window [mem 0xfcc00000-0xfcdfffff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.7: bridge window [mem 0xc020000000-0xc03fffffff 64bit pref] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:04.0: [1b36:000c] type 01 class 0x060400 PCIe Root Port Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:04.0: BAR 0 [mem 0xfea21000-0xfea21fff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:04.0: PCI bridge to [bus 12] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:04.0: bridge window [mem 0xfca00000-0xfcbfffff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:04.0: bridge window [mem 0xc000000000-0xc01fffffff 64bit pref] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:1f.0: [8086:2918] type 00 class 0x060100 conventional PCI endpoint Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:1f.0: quirk: [io 0x0600-0x067f] claimed by ICH6 ACPI/GPIO/TCO Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:1f.2: [8086:2922] type 00 class 0x010601 conventional PCI endpoint Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:1f.2: BAR 4 [io 0xd040-0xd05f] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:1f.2: BAR 5 [mem 0xfea22000-0xfea22fff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:1f.3: [8086:2930] type 00 class 0x0c0500 conventional PCI endpoint Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:1f.3: BAR 4 [io 0x0700-0x073f] Jul 15 13:05:38 np0000005197 kernel: pci 0000:01:00.0: [1b36:000e] type 01 class 0x060400 PCIe to PCI/PCI-X bridge Jul 15 13:05:38 np0000005197 kernel: pci 0000:01:00.0: BAR 0 [mem 0xfc800000-0xfc8000ff 64bit] Jul 15 13:05:38 np0000005197 kernel: pci 0000:01:00.0: PCI bridge to [bus 02] Jul 15 13:05:38 np0000005197 kernel: pci 0000:01:00.0: bridge window [io 0xc000-0xcfff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:01:00.0: bridge window [mem 0xfc600000-0xfc7fffff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:01:00.0: bridge window [mem 0xc200000000-0xc21fffffff 64bit pref] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.0: PCI bridge to [bus 01-02] Jul 15 13:05:38 np0000005197 kernel: pci_bus 0000:02: extended config space not accessible Jul 15 13:05:38 np0000005197 kernel: acpiphp: Slot [1] registered Jul 15 13:05:38 np0000005197 kernel: acpiphp: Slot [0] registered Jul 15 13:05:38 np0000005197 kernel: acpiphp: Slot [2] registered Jul 15 13:05:38 np0000005197 kernel: acpiphp: Slot [3] registered Jul 15 13:05:38 np0000005197 kernel: acpiphp: Slot [4] registered Jul 15 13:05:38 np0000005197 kernel: acpiphp: Slot [5] registered Jul 15 13:05:38 np0000005197 kernel: acpiphp: Slot [6] registered Jul 15 13:05:38 np0000005197 kernel: acpiphp: Slot [7] registered Jul 15 13:05:38 np0000005197 kernel: acpiphp: Slot [8] registered Jul 15 13:05:38 np0000005197 kernel: acpiphp: Slot [9] registered Jul 15 13:05:38 np0000005197 kernel: acpiphp: Slot [10] registered Jul 15 13:05:38 np0000005197 kernel: acpiphp: Slot [11] registered Jul 15 13:05:38 np0000005197 kernel: acpiphp: Slot [12] registered Jul 15 13:05:38 np0000005197 kernel: acpiphp: Slot [13] registered Jul 15 13:05:38 np0000005197 kernel: acpiphp: Slot [14] registered Jul 15 13:05:38 np0000005197 kernel: acpiphp: Slot [15] registered Jul 15 13:05:38 np0000005197 kernel: acpiphp: Slot [16] registered Jul 15 13:05:38 np0000005197 kernel: acpiphp: Slot [17] registered Jul 15 13:05:38 np0000005197 kernel: acpiphp: Slot [18] registered Jul 15 13:05:38 np0000005197 kernel: acpiphp: Slot [19] registered Jul 15 13:05:38 np0000005197 kernel: acpiphp: Slot [20] registered Jul 15 13:05:38 np0000005197 kernel: acpiphp: Slot [21] registered Jul 15 13:05:38 np0000005197 kernel: acpiphp: Slot [22] registered Jul 15 13:05:38 np0000005197 kernel: acpiphp: Slot [23] registered Jul 15 13:05:38 np0000005197 kernel: acpiphp: Slot [24] registered Jul 15 13:05:38 np0000005197 kernel: acpiphp: Slot [25] registered Jul 15 13:05:38 np0000005197 kernel: acpiphp: Slot [26] registered Jul 15 13:05:38 np0000005197 kernel: acpiphp: Slot [27] registered Jul 15 13:05:38 np0000005197 kernel: acpiphp: Slot [28] registered Jul 15 13:05:38 np0000005197 kernel: acpiphp: Slot [29] registered Jul 15 13:05:38 np0000005197 kernel: acpiphp: Slot [30] registered Jul 15 13:05:38 np0000005197 kernel: acpiphp: Slot [31] registered Jul 15 13:05:38 np0000005197 kernel: pci 0000:02:01.0: [8086:7020] type 00 class 0x0c0300 conventional PCI endpoint Jul 15 13:05:38 np0000005197 kernel: pci 0000:02:01.0: BAR 4 [io 0xc000-0xc01f] Jul 15 13:05:38 np0000005197 kernel: pci 0000:01:00.0: PCI bridge to [bus 02] Jul 15 13:05:38 np0000005197 kernel: acpiphp: Slot [0-2] registered Jul 15 13:05:38 np0000005197 kernel: pci 0000:03:00.0: [1af4:1041] type 00 class 0x020000 PCIe Endpoint Jul 15 13:05:38 np0000005197 kernel: pci 0000:03:00.0: BAR 1 [mem 0xfe880000-0xfe880fff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:03:00.0: BAR 4 [mem 0xc1e0000000-0xc1e0003fff 64bit pref] Jul 15 13:05:38 np0000005197 kernel: pci 0000:03:00.0: ROM [mem 0xfe800000-0xfe87ffff pref] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.1: PCI bridge to [bus 03] Jul 15 13:05:38 np0000005197 kernel: acpiphp: Slot [0-3] registered Jul 15 13:05:38 np0000005197 kernel: pci 0000:04:00.0: [1af4:1048] type 00 class 0x010000 PCIe Endpoint Jul 15 13:05:38 np0000005197 kernel: pci 0000:04:00.0: BAR 1 [mem 0xfe600000-0xfe600fff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:04:00.0: BAR 4 [mem 0xc1c0000000-0xc1c0003fff 64bit pref] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.2: PCI bridge to [bus 04] Jul 15 13:05:38 np0000005197 kernel: acpiphp: Slot [0-4] registered Jul 15 13:05:38 np0000005197 kernel: pci 0000:05:00.0: [1af4:1045] type 00 class 0x00ff00 PCIe Endpoint Jul 15 13:05:38 np0000005197 kernel: pci 0000:05:00.0: BAR 4 [mem 0xc1a0000000-0xc1a0003fff 64bit pref] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.3: PCI bridge to [bus 05] Jul 15 13:05:38 np0000005197 kernel: acpiphp: Slot [0-5] registered Jul 15 13:05:38 np0000005197 kernel: pci 0000:06:00.0: [1af4:1044] type 00 class 0x00ff00 PCIe Endpoint Jul 15 13:05:38 np0000005197 kernel: pci 0000:06:00.0: BAR 1 [mem 0xfe200000-0xfe200fff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:06:00.0: BAR 4 [mem 0xc180000000-0xc180003fff 64bit pref] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.4: PCI bridge to [bus 06] Jul 15 13:05:38 np0000005197 kernel: acpiphp: Slot [0-6] registered Jul 15 13:05:38 np0000005197 kernel: pci 0000:07:00.0: [1af4:1041] type 00 class 0x020000 PCIe Endpoint Jul 15 13:05:38 np0000005197 kernel: pci 0000:07:00.0: BAR 1 [mem 0xfe080000-0xfe080fff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:07:00.0: BAR 4 [mem 0xc160000000-0xc160003fff 64bit pref] Jul 15 13:05:38 np0000005197 kernel: pci 0000:07:00.0: ROM [mem 0xfe000000-0xfe07ffff pref] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.5: PCI bridge to [bus 07] Jul 15 13:05:38 np0000005197 kernel: acpiphp: Slot [0-7] registered Jul 15 13:05:38 np0000005197 kernel: pci 0000:08:00.0: [1af4:1041] type 00 class 0x020000 PCIe Endpoint Jul 15 13:05:38 np0000005197 kernel: pci 0000:08:00.0: BAR 1 [mem 0xfde80000-0xfde80fff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:08:00.0: BAR 4 [mem 0xc140000000-0xc140003fff 64bit pref] Jul 15 13:05:38 np0000005197 kernel: pci 0000:08:00.0: ROM [mem 0xfde00000-0xfde7ffff pref] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.6: PCI bridge to [bus 08] Jul 15 13:05:38 np0000005197 kernel: acpiphp: Slot [0-8] registered Jul 15 13:05:38 np0000005197 kernel: pci 0000:09:00.0: [1af4:1041] type 00 class 0x020000 PCIe Endpoint Jul 15 13:05:38 np0000005197 kernel: pci 0000:09:00.0: BAR 1 [mem 0xfdc80000-0xfdc80fff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:09:00.0: BAR 4 [mem 0xc120000000-0xc120003fff 64bit pref] Jul 15 13:05:38 np0000005197 kernel: pci 0000:09:00.0: ROM [mem 0xfdc00000-0xfdc7ffff pref] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.7: PCI bridge to [bus 09] Jul 15 13:05:38 np0000005197 kernel: acpiphp: Slot [0-9] registered Jul 15 13:05:38 np0000005197 kernel: pci 0000:0a:00.0: [1af4:1041] type 00 class 0x020000 PCIe Endpoint Jul 15 13:05:38 np0000005197 kernel: pci 0000:0a:00.0: BAR 1 [mem 0xfda80000-0xfda80fff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:0a:00.0: BAR 4 [mem 0xc100000000-0xc100003fff 64bit pref] Jul 15 13:05:38 np0000005197 kernel: pci 0000:0a:00.0: ROM [mem 0xfda00000-0xfda7ffff pref] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.0: PCI bridge to [bus 0a] Jul 15 13:05:38 np0000005197 kernel: acpiphp: Slot [0-10] registered Jul 15 13:05:38 np0000005197 kernel: pci 0000:0b:00.0: [1af4:1041] type 00 class 0x020000 PCIe Endpoint Jul 15 13:05:38 np0000005197 kernel: pci 0000:0b:00.0: BAR 1 [mem 0xfd880000-0xfd880fff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:0b:00.0: BAR 4 [mem 0xc0e0000000-0xc0e0003fff 64bit pref] Jul 15 13:05:38 np0000005197 kernel: pci 0000:0b:00.0: ROM [mem 0xfd800000-0xfd87ffff pref] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.1: PCI bridge to [bus 0b] Jul 15 13:05:38 np0000005197 kernel: acpiphp: Slot [0-11] registered Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.2: PCI bridge to [bus 0c] Jul 15 13:05:38 np0000005197 kernel: acpiphp: Slot [0-12] registered Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.3: PCI bridge to [bus 0d] Jul 15 13:05:38 np0000005197 kernel: acpiphp: Slot [0-13] registered Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.4: PCI bridge to [bus 0e] Jul 15 13:05:38 np0000005197 kernel: acpiphp: Slot [0-14] registered Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.5: PCI bridge to [bus 0f] Jul 15 13:05:38 np0000005197 kernel: acpiphp: Slot [0-15] registered Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.6: PCI bridge to [bus 10] Jul 15 13:05:38 np0000005197 kernel: acpiphp: Slot [0-16] registered Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.7: PCI bridge to [bus 11] Jul 15 13:05:38 np0000005197 kernel: acpiphp: Slot [0-17] registered Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:04.0: PCI bridge to [bus 12] Jul 15 13:05:38 np0000005197 kernel: ACPI: PCI: Interrupt link LNKA configured for IRQ 10 Jul 15 13:05:38 np0000005197 kernel: ACPI: PCI: Interrupt link LNKB configured for IRQ 10 Jul 15 13:05:38 np0000005197 kernel: ACPI: PCI: Interrupt link LNKC configured for IRQ 11 Jul 15 13:05:38 np0000005197 kernel: ACPI: PCI: Interrupt link LNKD configured for IRQ 11 Jul 15 13:05:38 np0000005197 kernel: ACPI: PCI: Interrupt link LNKE configured for IRQ 10 Jul 15 13:05:38 np0000005197 kernel: ACPI: PCI: Interrupt link LNKF configured for IRQ 10 Jul 15 13:05:38 np0000005197 kernel: ACPI: PCI: Interrupt link LNKG configured for IRQ 11 Jul 15 13:05:38 np0000005197 kernel: ACPI: PCI: Interrupt link LNKH configured for IRQ 11 Jul 15 13:05:38 np0000005197 kernel: ACPI: PCI: Interrupt link GSIA configured for IRQ 16 Jul 15 13:05:38 np0000005197 kernel: ACPI: PCI: Interrupt link GSIB configured for IRQ 17 Jul 15 13:05:38 np0000005197 kernel: ACPI: PCI: Interrupt link GSIC configured for IRQ 18 Jul 15 13:05:38 np0000005197 kernel: ACPI: PCI: Interrupt link GSID configured for IRQ 19 Jul 15 13:05:38 np0000005197 kernel: ACPI: PCI: Interrupt link GSIE configured for IRQ 20 Jul 15 13:05:38 np0000005197 kernel: ACPI: PCI: Interrupt link GSIF configured for IRQ 21 Jul 15 13:05:38 np0000005197 kernel: ACPI: PCI: Interrupt link GSIG configured for IRQ 22 Jul 15 13:05:38 np0000005197 kernel: ACPI: PCI: Interrupt link GSIH configured for IRQ 23 Jul 15 13:05:38 np0000005197 kernel: iommu: Default domain type: Translated Jul 15 13:05:38 np0000005197 kernel: iommu: DMA domain TLB invalidation policy: lazy mode Jul 15 13:05:38 np0000005197 kernel: SCSI subsystem initialized Jul 15 13:05:38 np0000005197 kernel: libata version 3.00 loaded. Jul 15 13:05:38 np0000005197 kernel: ACPI: bus type USB registered Jul 15 13:05:38 np0000005197 kernel: usbcore: registered new interface driver usbfs Jul 15 13:05:38 np0000005197 kernel: usbcore: registered new interface driver hub Jul 15 13:05:38 np0000005197 kernel: usbcore: registered new device driver usb Jul 15 13:05:38 np0000005197 kernel: pps_core: LinuxPPS API ver. 1 registered Jul 15 13:05:38 np0000005197 kernel: pps_core: Software ver. 5.3.6 - Copyright 2005-2007 Rodolfo Giometti Jul 15 13:05:38 np0000005197 kernel: PTP clock support registered Jul 15 13:05:38 np0000005197 kernel: EDAC MC: Ver: 3.0.0 Jul 15 13:05:38 np0000005197 kernel: NetLabel: Initializing Jul 15 13:05:38 np0000005197 kernel: NetLabel: domain hash size = 128 Jul 15 13:05:38 np0000005197 kernel: NetLabel: protocols = UNLABELED CIPSOv4 CALIPSO Jul 15 13:05:38 np0000005197 kernel: NetLabel: unlabeled traffic allowed by default Jul 15 13:05:38 np0000005197 kernel: mctp: management component transport protocol core Jul 15 13:05:38 np0000005197 kernel: NET: Registered PF_MCTP protocol family Jul 15 13:05:38 np0000005197 kernel: PCI: Using ACPI for IRQ routing Jul 15 13:05:38 np0000005197 kernel: PCI: pci_cache_line_size set to 64 bytes Jul 15 13:05:38 np0000005197 kernel: e820: reserve RAM buffer [mem 0x0009fc00-0x0009ffff] Jul 15 13:05:38 np0000005197 kernel: e820: reserve RAM buffer [mem 0x7ffdb000-0x7fffffff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:01.0: vgaarb: setting as boot VGA device Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:01.0: vgaarb: bridge control possible Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:01.0: vgaarb: VGA device added: decodes=io+mem,owns=io+mem,locks=none Jul 15 13:05:38 np0000005197 kernel: vgaarb: loaded Jul 15 13:05:38 np0000005197 kernel: clocksource: Switched to clocksource kvm-clock Jul 15 13:05:38 np0000005197 kernel: VFS: Disk quotas dquot_6.6.0 Jul 15 13:05:38 np0000005197 kernel: VFS: Dquot-cache hash table entries: 512 (order 0, 4096 bytes) Jul 15 13:05:38 np0000005197 kernel: AppArmor: AppArmor Filesystem Enabled Jul 15 13:05:38 np0000005197 kernel: pnp: PnP ACPI init Jul 15 13:05:38 np0000005197 kernel: system 00:04: [mem 0xb0000000-0xbfffffff window] has been reserved Jul 15 13:05:38 np0000005197 kernel: pnp: PnP ACPI: found 5 devices Jul 15 13:05:38 np0000005197 kernel: clocksource: acpi_pm: mask: 0xffffff max_cycles: 0xffffff, max_idle_ns: 2085701024 ns Jul 15 13:05:38 np0000005197 kernel: NET: Registered PF_INET protocol family Jul 15 13:05:38 np0000005197 kernel: IP idents hash table entries: 262144 (order: 9, 2097152 bytes, linear) Jul 15 13:05:38 np0000005197 kernel: tcp_listen_portaddr_hash hash table entries: 16384 (order: 6, 262144 bytes, linear) Jul 15 13:05:38 np0000005197 kernel: Table-perturb hash table entries: 65536 (order: 6, 262144 bytes, linear) Jul 15 13:05:38 np0000005197 kernel: TCP established hash table entries: 262144 (order: 9, 2097152 bytes, linear) Jul 15 13:05:38 np0000005197 kernel: TCP bind hash table entries: 65536 (order: 9, 2097152 bytes, linear) Jul 15 13:05:38 np0000005197 kernel: TCP: Hash tables configured (established 262144 bind 65536) Jul 15 13:05:38 np0000005197 kernel: MPTCP token hash table entries: 32768 (order: 8, 786432 bytes, linear) Jul 15 13:05:38 np0000005197 kernel: UDP hash table entries: 16384 (order: 7, 524288 bytes, linear) Jul 15 13:05:38 np0000005197 kernel: UDP-Lite hash table entries: 16384 (order: 7, 524288 bytes, linear) Jul 15 13:05:38 np0000005197 kernel: NET: Registered PF_UNIX/PF_LOCAL protocol family Jul 15 13:05:38 np0000005197 kernel: NET: Registered PF_XDP protocol family Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.1: bridge window [io 0x1000-0x0fff] to [bus 03] add_size 1000 Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.2: bridge window [io 0x1000-0x0fff] to [bus 04] add_size 1000 Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.3: bridge window [io 0x1000-0x0fff] to [bus 05] add_size 1000 Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.4: bridge window [io 0x1000-0x0fff] to [bus 06] add_size 1000 Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.5: bridge window [io 0x1000-0x0fff] to [bus 07] add_size 1000 Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.6: bridge window [io 0x1000-0x0fff] to [bus 08] add_size 1000 Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.7: bridge window [io 0x1000-0x0fff] to [bus 09] add_size 1000 Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.0: bridge window [io 0x1000-0x0fff] to [bus 0a] add_size 1000 Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.1: bridge window [io 0x1000-0x0fff] to [bus 0b] add_size 1000 Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.2: bridge window [io 0x1000-0x0fff] to [bus 0c] add_size 1000 Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.3: bridge window [io 0x1000-0x0fff] to [bus 0d] add_size 1000 Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.4: bridge window [io 0x1000-0x0fff] to [bus 0e] add_size 1000 Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.5: bridge window [io 0x1000-0x0fff] to [bus 0f] add_size 1000 Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.6: bridge window [io 0x1000-0x0fff] to [bus 10] add_size 1000 Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.7: bridge window [io 0x1000-0x0fff] to [bus 11] add_size 1000 Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:04.0: bridge window [io 0x1000-0x0fff] to [bus 12] add_size 1000 Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.1: bridge window [io 0x1000-0x1fff]: assigned Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.2: bridge window [io 0x2000-0x2fff]: assigned Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.3: bridge window [io 0x3000-0x3fff]: assigned Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.4: bridge window [io 0x4000-0x4fff]: assigned Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.5: bridge window [io 0x5000-0x5fff]: assigned Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.6: bridge window [io 0x6000-0x6fff]: assigned Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.7: bridge window [io 0x7000-0x7fff]: assigned Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.0: bridge window [io 0x8000-0x8fff]: assigned Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.1: bridge window [io 0x9000-0x9fff]: assigned Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.2: bridge window [io 0xa000-0xafff]: assigned Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.3: bridge window [io 0xb000-0xbfff]: assigned Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.4: bridge window [io 0xe000-0xefff]: assigned Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.5: bridge window [io 0xf000-0xffff]: assigned Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.6: bridge window [io size 0x1000]: can't assign; no space Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.6: bridge window [io size 0x1000]: failed to assign Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.7: bridge window [io size 0x1000]: can't assign; no space Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.7: bridge window [io size 0x1000]: failed to assign Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:04.0: bridge window [io size 0x1000]: can't assign; no space Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:04.0: bridge window [io size 0x1000]: failed to assign Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:04.0: bridge window [io 0x1000-0x1fff]: assigned Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.7: bridge window [io 0x2000-0x2fff]: assigned Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.6: bridge window [io 0x3000-0x3fff]: assigned Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.5: bridge window [io 0x4000-0x4fff]: assigned Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.4: bridge window [io 0x5000-0x5fff]: assigned Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.3: bridge window [io 0x6000-0x6fff]: assigned Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.2: bridge window [io 0x7000-0x7fff]: assigned Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.1: bridge window [io 0x8000-0x8fff]: assigned Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.0: bridge window [io 0x9000-0x9fff]: assigned Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.7: bridge window [io 0xa000-0xafff]: assigned Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.6: bridge window [io 0xb000-0xbfff]: assigned Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.5: bridge window [io 0xe000-0xefff]: assigned Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.4: bridge window [io 0xf000-0xffff]: assigned Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.3: bridge window [io size 0x1000]: can't assign; no space Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.3: bridge window [io size 0x1000]: failed to assign Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.2: bridge window [io size 0x1000]: can't assign; no space Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.2: bridge window [io size 0x1000]: failed to assign Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.1: bridge window [io size 0x1000]: can't assign; no space Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.1: bridge window [io size 0x1000]: failed to assign Jul 15 13:05:38 np0000005197 kernel: pci 0000:01:00.0: PCI bridge to [bus 02] Jul 15 13:05:38 np0000005197 kernel: pci 0000:01:00.0: bridge window [io 0xc000-0xcfff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:01:00.0: bridge window [mem 0xfc600000-0xfc7fffff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:01:00.0: bridge window [mem 0xc200000000-0xc21fffffff 64bit pref] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.0: PCI bridge to [bus 01-02] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.0: bridge window [io 0xc000-0xcfff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.0: bridge window [mem 0xfc600000-0xfc9fffff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.0: bridge window [mem 0xc200000000-0xc21fffffff 64bit pref] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.1: PCI bridge to [bus 03] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.1: bridge window [mem 0xfe800000-0xfe9fffff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.1: bridge window [mem 0xc1e0000000-0xc1ffffffff 64bit pref] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.2: PCI bridge to [bus 04] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.2: bridge window [mem 0xfe600000-0xfe7fffff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.2: bridge window [mem 0xc1c0000000-0xc1dfffffff 64bit pref] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.3: PCI bridge to [bus 05] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.3: bridge window [mem 0xfe400000-0xfe5fffff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.3: bridge window [mem 0xc1a0000000-0xc1bfffffff 64bit pref] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.4: PCI bridge to [bus 06] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.4: bridge window [io 0xf000-0xffff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.4: bridge window [mem 0xfe200000-0xfe3fffff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.4: bridge window [mem 0xc180000000-0xc19fffffff 64bit pref] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.5: PCI bridge to [bus 07] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.5: bridge window [io 0xe000-0xefff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.5: bridge window [mem 0xfe000000-0xfe1fffff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.5: bridge window [mem 0xc160000000-0xc17fffffff 64bit pref] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.6: PCI bridge to [bus 08] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.6: bridge window [io 0xb000-0xbfff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.6: bridge window [mem 0xfde00000-0xfdffffff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.6: bridge window [mem 0xc140000000-0xc15fffffff 64bit pref] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.7: PCI bridge to [bus 09] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.7: bridge window [io 0xa000-0xafff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.7: bridge window [mem 0xfdc00000-0xfddfffff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:02.7: bridge window [mem 0xc120000000-0xc13fffffff 64bit pref] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.0: PCI bridge to [bus 0a] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.0: bridge window [io 0x9000-0x9fff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.0: bridge window [mem 0xfda00000-0xfdbfffff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.0: bridge window [mem 0xc100000000-0xc11fffffff 64bit pref] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.1: PCI bridge to [bus 0b] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.1: bridge window [io 0x8000-0x8fff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.1: bridge window [mem 0xfd800000-0xfd9fffff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.1: bridge window [mem 0xc0e0000000-0xc0ffffffff 64bit pref] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.2: PCI bridge to [bus 0c] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.2: bridge window [io 0x7000-0x7fff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.2: bridge window [mem 0xfd600000-0xfd7fffff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.2: bridge window [mem 0xc0c0000000-0xc0dfffffff 64bit pref] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.3: PCI bridge to [bus 0d] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.3: bridge window [io 0x6000-0x6fff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.3: bridge window [mem 0xfd400000-0xfd5fffff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.3: bridge window [mem 0xc0a0000000-0xc0bfffffff 64bit pref] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.4: PCI bridge to [bus 0e] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.4: bridge window [io 0x5000-0x5fff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.4: bridge window [mem 0xfd200000-0xfd3fffff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.4: bridge window [mem 0xc080000000-0xc09fffffff 64bit pref] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.5: PCI bridge to [bus 0f] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.5: bridge window [io 0x4000-0x4fff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.5: bridge window [mem 0xfd000000-0xfd1fffff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.5: bridge window [mem 0xc060000000-0xc07fffffff 64bit pref] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.6: PCI bridge to [bus 10] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.6: bridge window [io 0x3000-0x3fff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.6: bridge window [mem 0xfce00000-0xfcffffff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.6: bridge window [mem 0xc040000000-0xc05fffffff 64bit pref] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.7: PCI bridge to [bus 11] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.7: bridge window [io 0x2000-0x2fff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.7: bridge window [mem 0xfcc00000-0xfcdfffff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:03.7: bridge window [mem 0xc020000000-0xc03fffffff 64bit pref] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:04.0: PCI bridge to [bus 12] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:04.0: bridge window [io 0x1000-0x1fff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:04.0: bridge window [mem 0xfca00000-0xfcbfffff] Jul 15 13:05:38 np0000005197 kernel: pci 0000:00:04.0: bridge window [mem 0xc000000000-0xc01fffffff 64bit pref] Jul 15 13:05:38 np0000005197 kernel: pci_bus 0000:00: resource 4 [io 0x0000-0x0cf7 window] Jul 15 13:05:38 np0000005197 kernel: pci_bus 0000:00: resource 5 [io 0x0d00-0xffff window] Jul 15 13:05:38 np0000005197 kernel: pci_bus 0000:00: resource 6 [mem 0x000a0000-0x000bffff window] Jul 15 13:05:38 np0000005197 kernel: pci_bus 0000:00: resource 7 [mem 0x80000000-0xafffffff window] Jul 15 13:05:38 np0000005197 kernel: pci_bus 0000:00: resource 8 [mem 0xc0000000-0xfebfffff window] Jul 15 13:05:38 np0000005197 kernel: pci_bus 0000:00: resource 9 [mem 0xc000000000-0xc7ffffffff window] Jul 15 13:05:38 np0000005197 kernel: pci_bus 0000:01: resource 0 [io 0xc000-0xcfff] Jul 15 13:05:38 np0000005197 kernel: pci_bus 0000:01: resource 1 [mem 0xfc600000-0xfc9fffff] Jul 15 13:05:38 np0000005197 kernel: pci_bus 0000:01: resource 2 [mem 0xc200000000-0xc21fffffff 64bit pref] Jul 15 13:05:38 np0000005197 kernel: pci_bus 0000:02: resource 0 [io 0xc000-0xcfff] Jul 15 13:05:38 np0000005197 kernel: pci_bus 0000:02: resource 1 [mem 0xfc600000-0xfc7fffff] Jul 15 13:05:38 np0000005197 kernel: pci_bus 0000:02: resource 2 [mem 0xc200000000-0xc21fffffff 64bit pref] Jul 15 13:05:38 np0000005197 kernel: pci_bus 0000:03: resource 1 [mem 0xfe800000-0xfe9fffff] Jul 15 13:05:38 np0000005197 kernel: pci_bus 0000:03: resource 2 [mem 0xc1e0000000-0xc1ffffffff 64bit pref] Jul 15 13:05:38 np0000005197 kernel: pci_bus 0000:04: resource 1 [mem 0xfe600000-0xfe7fffff] Jul 15 13:05:38 np0000005197 kernel: pci_bus 0000:04: resource 2 [mem 0xc1c0000000-0xc1dfffffff 64bit pref] Jul 15 13:05:38 np0000005197 kernel: pci_bus 0000:05: resource 1 [mem 0xfe400000-0xfe5fffff] Jul 15 13:05:38 np0000005197 kernel: pci_bus 0000:05: resource 2 [mem 0xc1a0000000-0xc1bfffffff 64bit pref] Jul 15 13:05:38 np0000005197 kernel: pci_bus 0000:06: resource 0 [io 0xf000-0xffff] Jul 15 13:05:38 np0000005197 kernel: pci_bus 0000:06: resource 1 [mem 0xfe200000-0xfe3fffff] Jul 15 13:05:38 np0000005197 kernel: pci_bus 0000:06: resource 2 [mem 0xc180000000-0xc19fffffff 64bit pref] Jul 15 13:05:38 np0000005197 kernel: pci_bus 0000:07: resource 0 [io 0xe000-0xefff] Jul 15 13:05:38 np0000005197 kernel: pci_bus 0000:07: resource 1 [mem 0xfe000000-0xfe1fffff] Jul 15 13:05:38 np0000005197 kernel: pci_bus 0000:07: resource 2 [mem 0xc160000000-0xc17fffffff 64bit pref] Jul 15 13:05:38 np0000005197 kernel: pci_bus 0000:08: resource 0 [io 0xb000-0xbfff] Jul 15 13:05:38 np0000005197 kernel: pci_bus 0000:08: resource 1 [mem 0xfde00000-0xfdffffff] Jul 15 13:05:38 np0000005197 kernel: pci_bus 0000:08: resource 2 [mem 0xc140000000-0xc15fffffff 64bit pref] Jul 15 13:05:38 np0000005197 kernel: pci_bus 0000:09: resource 0 [io 0xa000-0xafff] Jul 15 13:05:38 np0000005197 kernel: pci_bus 0000:09: resource 1 [mem 0xfdc00000-0xfddfffff] Jul 15 13:05:38 np0000005197 kernel: pci_bus 0000:09: resource 2 [mem 0xc120000000-0xc13fffffff 64bit pref] Jul 15 13:05:38 np0000005197 kernel: pci_bus 0000:0a: resource 0 [io 0x9000-0x9fff] Jul 15 13:05:38 np0000005197 kernel: pci_bus 0000:0a: resource 1 [mem 0xfda00000-0xfdbfffff] Jul 15 13:05:38 np0000005197 kernel: pci_bus 0000:0a: resource 2 [mem 0xc100000000-0xc11fffffff 64bit pref] Jul 15 13:05:38 np0000005197 kernel: pci_bus 0000:0b: resource 0 [io 0x8000-0x8fff] Jul 15 13:05:38 np0000005197 kernel: pci_bus 0000:0b: resource 1 [mem 0xfd800000-0xfd9fffff] Jul 15 13:05:38 np0000005197 kernel: pci_bus 0000:0b: resource 2 [mem 0xc0e0000000-0xc0ffffffff 64bit pref] Jul 15 13:05:38 np0000005197 kernel: pci_bus 0000:0c: resource 0 [io 0x7000-0x7fff] Jul 15 13:05:38 np0000005197 kernel: pci_bus 0000:0c: resource 1 [mem 0xfd600000-0xfd7fffff] Jul 15 13:05:38 np0000005197 kernel: pci_bus 0000:0c: resource 2 [mem 0xc0c0000000-0xc0dfffffff 64bit pref] Jul 15 13:05:38 np0000005197 kernel: pci_bus 0000:0d: resource 0 [io 0x6000-0x6fff] Jul 15 13:05:38 np0000005197 kernel: pci_bus 0000:0d: resource 1 [mem 0xfd400000-0xfd5fffff] Jul 15 13:05:38 np0000005197 kernel: pci_bus 0000:0d: resource 2 [mem 0xc0a0000000-0xc0bfffffff 64bit pref] Jul 15 13:05:38 np0000005197 kernel: pci_bus 0000:0e: resource 0 [io 0x5000-0x5fff] Jul 15 13:05:38 np0000005197 kernel: pci_bus 0000:0e: resource 1 [mem 0xfd200000-0xfd3fffff] Jul 15 13:05:38 np0000005197 kernel: pci_bus 0000:0e: resource 2 [mem 0xc080000000-0xc09fffffff 64bit pref] Jul 15 13:05:38 np0000005197 kernel: pci_bus 0000:0f: resource 0 [io 0x4000-0x4fff] Jul 15 13:05:38 np0000005197 kernel: pci_bus 0000:0f: resource 1 [mem 0xfd000000-0xfd1fffff] Jul 15 13:05:38 np0000005197 kernel: pci_bus 0000:0f: resource 2 [mem 0xc060000000-0xc07fffffff 64bit pref] Jul 15 13:05:38 np0000005197 kernel: pci_bus 0000:10: resource 0 [io 0x3000-0x3fff] Jul 15 13:05:38 np0000005197 kernel: pci_bus 0000:10: resource 1 [mem 0xfce00000-0xfcffffff] Jul 15 13:05:38 np0000005197 kernel: pci_bus 0000:10: resource 2 [mem 0xc040000000-0xc05fffffff 64bit pref] Jul 15 13:05:38 np0000005197 kernel: pci_bus 0000:11: resource 0 [io 0x2000-0x2fff] Jul 15 13:05:38 np0000005197 kernel: pci_bus 0000:11: resource 1 [mem 0xfcc00000-0xfcdfffff] Jul 15 13:05:38 np0000005197 kernel: pci_bus 0000:11: resource 2 [mem 0xc020000000-0xc03fffffff 64bit pref] Jul 15 13:05:38 np0000005197 kernel: pci_bus 0000:12: resource 0 [io 0x1000-0x1fff] Jul 15 13:05:38 np0000005197 kernel: pci_bus 0000:12: resource 1 [mem 0xfca00000-0xfcbfffff] Jul 15 13:05:38 np0000005197 kernel: pci_bus 0000:12: resource 2 [mem 0xc000000000-0xc01fffffff 64bit pref] Jul 15 13:05:38 np0000005197 kernel: ACPI: \_SB_.GSIG: Enabled at IRQ 22 Jul 15 13:05:38 np0000005197 kernel: PCI: CLS 0 bytes, default 64 Jul 15 13:05:38 np0000005197 kernel: Trying to unpack rootfs image as initramfs... Jul 15 13:05:38 np0000005197 kernel: PCI-DMA: Using software bounce buffering for IO (SWIOTLB) Jul 15 13:05:38 np0000005197 kernel: software IO TLB: mapped [mem 0x000000003b000000-0x000000003f000000] (64MB) Jul 15 13:05:38 np0000005197 kernel: Initialise system trusted keyrings Jul 15 13:05:38 np0000005197 kernel: Key type blacklist registered Jul 15 13:05:38 np0000005197 kernel: workingset: timestamp_bits=36 max_order=23 bucket_order=0 Jul 15 13:05:38 np0000005197 kernel: zbud: loaded Jul 15 13:05:38 np0000005197 kernel: squashfs: version 4.0 (2009/01/31) Phillip Lougher Jul 15 13:05:38 np0000005197 kernel: fuse: init (API version 7.39) Jul 15 13:05:38 np0000005197 kernel: integrity: Platform Keyring initialized Jul 15 13:05:38 np0000005197 kernel: integrity: Machine keyring initialized Jul 15 13:05:38 np0000005197 kernel: Key type asymmetric registered Jul 15 13:05:38 np0000005197 kernel: Asymmetric key parser 'x509' registered Jul 15 13:05:38 np0000005197 kernel: Block layer SCSI generic (bsg) driver version 0.4 loaded (major 243) Jul 15 13:05:38 np0000005197 kernel: io scheduler mq-deadline registered Jul 15 13:05:38 np0000005197 kernel: pcieport 0000:00:02.0: PME: Signaling with IRQ 24 Jul 15 13:05:38 np0000005197 kernel: pcieport 0000:00:02.0: AER: enabled with IRQ 24 Jul 15 13:05:38 np0000005197 kernel: pcieport 0000:00:02.1: PME: Signaling with IRQ 25 Jul 15 13:05:38 np0000005197 kernel: pcieport 0000:00:02.1: AER: enabled with IRQ 25 Jul 15 13:05:38 np0000005197 kernel: pcieport 0000:00:02.2: PME: Signaling with IRQ 26 Jul 15 13:05:38 np0000005197 kernel: pcieport 0000:00:02.2: AER: enabled with IRQ 26 Jul 15 13:05:38 np0000005197 kernel: pcieport 0000:00:02.3: PME: Signaling with IRQ 27 Jul 15 13:05:38 np0000005197 kernel: pcieport 0000:00:02.3: AER: enabled with IRQ 27 Jul 15 13:05:38 np0000005197 kernel: pcieport 0000:00:02.4: PME: Signaling with IRQ 28 Jul 15 13:05:38 np0000005197 kernel: pcieport 0000:00:02.4: AER: enabled with IRQ 28 Jul 15 13:05:38 np0000005197 kernel: pcieport 0000:00:02.5: PME: Signaling with IRQ 29 Jul 15 13:05:38 np0000005197 kernel: pcieport 0000:00:02.5: AER: enabled with IRQ 29 Jul 15 13:05:38 np0000005197 kernel: pcieport 0000:00:02.6: PME: Signaling with IRQ 30 Jul 15 13:05:38 np0000005197 kernel: pcieport 0000:00:02.6: AER: enabled with IRQ 30 Jul 15 13:05:38 np0000005197 kernel: pcieport 0000:00:02.7: PME: Signaling with IRQ 31 Jul 15 13:05:38 np0000005197 kernel: pcieport 0000:00:02.7: AER: enabled with IRQ 31 Jul 15 13:05:38 np0000005197 kernel: ACPI: \_SB_.GSIH: Enabled at IRQ 23 Jul 15 13:05:38 np0000005197 kernel: pcieport 0000:00:03.0: PME: Signaling with IRQ 32 Jul 15 13:05:38 np0000005197 kernel: pcieport 0000:00:03.0: AER: enabled with IRQ 32 Jul 15 13:05:38 np0000005197 kernel: pcieport 0000:00:03.1: PME: Signaling with IRQ 33 Jul 15 13:05:38 np0000005197 kernel: pcieport 0000:00:03.1: AER: enabled with IRQ 33 Jul 15 13:05:38 np0000005197 kernel: pcieport 0000:00:03.2: PME: Signaling with IRQ 34 Jul 15 13:05:38 np0000005197 kernel: pcieport 0000:00:03.2: AER: enabled with IRQ 34 Jul 15 13:05:38 np0000005197 kernel: pcieport 0000:00:03.3: PME: Signaling with IRQ 35 Jul 15 13:05:38 np0000005197 kernel: pcieport 0000:00:03.3: AER: enabled with IRQ 35 Jul 15 13:05:38 np0000005197 kernel: pcieport 0000:00:03.4: PME: Signaling with IRQ 36 Jul 15 13:05:38 np0000005197 kernel: pcieport 0000:00:03.4: AER: enabled with IRQ 36 Jul 15 13:05:38 np0000005197 kernel: pcieport 0000:00:03.5: PME: Signaling with IRQ 37 Jul 15 13:05:38 np0000005197 kernel: pcieport 0000:00:03.5: AER: enabled with IRQ 37 Jul 15 13:05:38 np0000005197 kernel: pcieport 0000:00:03.6: PME: Signaling with IRQ 38 Jul 15 13:05:38 np0000005197 kernel: pcieport 0000:00:03.6: AER: enabled with IRQ 38 Jul 15 13:05:38 np0000005197 kernel: pcieport 0000:00:03.7: PME: Signaling with IRQ 39 Jul 15 13:05:38 np0000005197 kernel: pcieport 0000:00:03.7: AER: enabled with IRQ 39 Jul 15 13:05:38 np0000005197 kernel: Freeing initrd memory: 30324K Jul 15 13:05:38 np0000005197 kernel: ACPI: \_SB_.GSIE: Enabled at IRQ 20 Jul 15 13:05:38 np0000005197 kernel: pcieport 0000:00:04.0: PME: Signaling with IRQ 40 Jul 15 13:05:38 np0000005197 kernel: pcieport 0000:00:04.0: AER: enabled with IRQ 40 Jul 15 13:05:38 np0000005197 kernel: shpchp 0000:01:00.0: HPC vendor_id 1b36 device_id e ss_vid 0 ss_did 0 Jul 15 13:05:38 np0000005197 kernel: shpchp 0000:01:00.0: pci_hp_register failed with error -16 Jul 15 13:05:38 np0000005197 kernel: shpchp 0000:01:00.0: Slot initialization failed Jul 15 13:05:38 np0000005197 kernel: shpchp: Standard Hot Plug PCI Controller Driver version: 0.4 Jul 15 13:05:38 np0000005197 kernel: Driver imsttfb not loading because of nomodeset parameter Jul 15 13:05:38 np0000005197 kernel: Driver asiliantfb not loading because of nomodeset parameter Jul 15 13:05:38 np0000005197 kernel: input: Power Button as /devices/LNXSYSTM:00/LNXPWRBN:00/input/input0 Jul 15 13:05:38 np0000005197 kernel: ACPI: button: Power Button [PWRF] Jul 15 13:05:38 np0000005197 kernel: ACPI: \_SB_.GSIF: Enabled at IRQ 21 Jul 15 13:05:38 np0000005197 kernel: Free page reporting enabled Jul 15 13:05:38 np0000005197 kernel: Serial: 8250/16550 driver, 32 ports, IRQ sharing enabled Jul 15 13:05:38 np0000005197 kernel: 00:00: ttyS0 at I/O 0x3f8 (irq = 4, base_baud = 115200) is a 16550A Jul 15 13:05:38 np0000005197 kernel: Linux agpgart interface v0.103 Jul 15 13:05:38 np0000005197 kernel: loop: module loaded Jul 15 13:05:38 np0000005197 kernel: virtio_scsi virtio2: 12/0/0 default/read/poll queues Jul 15 13:05:38 np0000005197 kernel: scsi host0: Virtio SCSI HBA Jul 15 13:05:38 np0000005197 kernel: ACPI: bus type drm_connector registered Jul 15 13:05:38 np0000005197 kernel: scsi 0:0:0:0: Direct-Access QEMU QEMU HARDDISK 2.5+ PQ: 0 ANSI: 5 Jul 15 13:05:38 np0000005197 kernel: tun: Universal TUN/TAP device driver, 1.6 Jul 15 13:05:38 np0000005197 kernel: scsi 0:0:0:1: Direct-Access QEMU QEMU HARDDISK 2.5+ PQ: 0 ANSI: 5 Jul 15 13:05:38 np0000005197 kernel: PPP generic driver version 2.4.2 Jul 15 13:05:38 np0000005197 kernel: uhci_hcd 0000:02:01.0: UHCI Host Controller Jul 15 13:05:38 np0000005197 kernel: uhci_hcd 0000:02:01.0: new USB bus registered, assigned bus number 1 Jul 15 13:05:38 np0000005197 kernel: uhci_hcd 0000:02:01.0: detected 2 ports Jul 15 13:05:38 np0000005197 kernel: uhci_hcd 0000:02:01.0: irq 22, io port 0x0000c000 Jul 15 13:05:38 np0000005197 kernel: usb usb1: New USB device found, idVendor=1d6b, idProduct=0001, bcdDevice= 6.08 Jul 15 13:05:38 np0000005197 kernel: usb usb1: New USB device strings: Mfr=3, Product=2, SerialNumber=1 Jul 15 13:05:38 np0000005197 kernel: usb usb1: Product: UHCI Host Controller Jul 15 13:05:38 np0000005197 kernel: usb usb1: Manufacturer: Linux 6.8.0-134-generic uhci_hcd Jul 15 13:05:38 np0000005197 kernel: usb usb1: SerialNumber: 0000:02:01.0 Jul 15 13:05:38 np0000005197 kernel: hub 1-0:1.0: USB hub found Jul 15 13:05:38 np0000005197 kernel: hub 1-0:1.0: 2 ports detected Jul 15 13:05:38 np0000005197 kernel: i8042: PNP: PS/2 Controller [PNP0303:KBD,PNP0f13:MOU] at 0x60,0x64 irq 1,12 Jul 15 13:05:38 np0000005197 kernel: serio: i8042 KBD port at 0x60,0x64 irq 1 Jul 15 13:05:38 np0000005197 kernel: serio: i8042 AUX port at 0x60,0x64 irq 12 Jul 15 13:05:38 np0000005197 kernel: scsi 0:0:0:0: Attached scsi generic sg0 type 0 Jul 15 13:05:38 np0000005197 kernel: mousedev: PS/2 mouse device common for all mice Jul 15 13:05:38 np0000005197 kernel: scsi 0:0:0:1: Attached scsi generic sg1 type 0 Jul 15 13:05:38 np0000005197 kernel: sd 0:0:0:0: Power-on or device reset occurred Jul 15 13:05:38 np0000005197 kernel: sd 0:0:0:0: [sda] 209715200 512-byte logical blocks: (107 GB/100 GiB) Jul 15 13:05:38 np0000005197 kernel: sd 0:0:0:0: [sda] Write Protect is off Jul 15 13:05:38 np0000005197 kernel: sd 0:0:0:0: [sda] Mode Sense: 63 00 00 08 Jul 15 13:05:38 np0000005197 kernel: sd 0:0:0:0: [sda] Write cache: enabled, read cache: enabled, doesn't support DPO or FUA Jul 15 13:05:38 np0000005197 kernel: rtc_cmos 00:03: RTC can wake from S4 Jul 15 13:05:38 np0000005197 kernel: sda: sda1 sda14 sda15 sda16 Jul 15 13:05:38 np0000005197 kernel: sd 0:0:0:1: Power-on or device reset occurred Jul 15 13:05:38 np0000005197 kernel: sd 0:0:0:1: [sdb] 482344960 512-byte logical blocks: (247 GB/230 GiB) Jul 15 13:05:38 np0000005197 kernel: sd 0:0:0:1: [sdb] Write Protect is off Jul 15 13:05:38 np0000005197 kernel: sd 0:0:0:0: [sda] Attached SCSI disk Jul 15 13:05:38 np0000005197 kernel: input: AT Translated Set 2 keyboard as /devices/platform/i8042/serio0/input/input1 Jul 15 13:05:38 np0000005197 kernel: rtc_cmos 00:03: registered as rtc0 Jul 15 13:05:38 np0000005197 kernel: rtc_cmos 00:03: setting system clock to 2026-07-15T13:05:36 UTC (1784120736) Jul 15 13:05:38 np0000005197 kernel: rtc_cmos 00:03: alarms up to one day, y3k, 242 bytes nvram Jul 15 13:05:38 np0000005197 kernel: i2c_dev: i2c /dev entries driver Jul 15 13:05:38 np0000005197 kernel: sd 0:0:0:1: [sdb] Mode Sense: 63 00 00 08 Jul 15 13:05:38 np0000005197 kernel: device-mapper: core: CONFIG_IMA_DISABLE_HTABLE is disabled. Duplicate IMA measurements will not be recorded in the IMA log. Jul 15 13:05:38 np0000005197 kernel: device-mapper: uevent: version 1.0.3 Jul 15 13:05:38 np0000005197 kernel: device-mapper: ioctl: 4.48.0-ioctl (2023-03-01) initialised: dm-devel@redhat.com Jul 15 13:05:38 np0000005197 kernel: amd_pstate: the _CPC object is not present in SBIOS or ACPI disabled Jul 15 13:05:38 np0000005197 kernel: sd 0:0:0:1: [sdb] Write cache: enabled, read cache: enabled, doesn't support DPO or FUA Jul 15 13:05:38 np0000005197 kernel: ledtrig-cpu: registered to indicate activity on CPUs Jul 15 13:05:38 np0000005197 kernel: sd 0:0:0:1: [sdb] Attached SCSI disk Jul 15 13:05:38 np0000005197 kernel: drop_monitor: Initializing network drop monitor service Jul 15 13:05:38 np0000005197 kernel: NET: Registered PF_INET6 protocol family Jul 15 13:05:38 np0000005197 kernel: Segment Routing with IPv6 Jul 15 13:05:38 np0000005197 kernel: In-situ OAM (IOAM) with IPv6 Jul 15 13:05:38 np0000005197 kernel: NET: Registered PF_PACKET protocol family Jul 15 13:05:38 np0000005197 kernel: Key type dns_resolver registered Jul 15 13:05:38 np0000005197 kernel: IPI shorthand broadcast: enabled Jul 15 13:05:38 np0000005197 kernel: sched_clock: Marking stable (1150003484, 82423538)->(1298653746, -66226724) Jul 15 13:05:38 np0000005197 kernel: registered taskstats version 1 Jul 15 13:05:38 np0000005197 kernel: Loading compiled-in X.509 certificates Jul 15 13:05:38 np0000005197 kernel: Loaded X.509 cert 'Build time autogenerated kernel key: 79aab6b364387381d7a5d225dcfcd094a654ef62' Jul 15 13:05:38 np0000005197 kernel: Loaded X.509 cert 'Canonical Ltd. Live Patch Signing 2025 Kmod: d541cef61dc7e793b7eb7e899970a2eef0b5dc8c' Jul 15 13:05:38 np0000005197 kernel: Loaded X.509 cert 'Canonical Ltd. Live Patch Signing: 14df34d1a87cf37625abec039ef2bf521249b969' Jul 15 13:05:38 np0000005197 kernel: Loaded X.509 cert 'Canonical Ltd. Kernel Module Signing 2025 Kmod: 4627603d2357a2a3f81006370894c221175893e9' Jul 15 13:05:38 np0000005197 kernel: Loaded X.509 cert 'Canonical Ltd. Kernel Module Signing: 88f752e560a1e0737e31163a466ad7b70a850c19' Jul 15 13:05:38 np0000005197 kernel: blacklist: Loading compiled-in revocation X.509 certificates Jul 15 13:05:38 np0000005197 kernel: Loaded X.509 cert 'Canonical Ltd. Secure Boot Signing: 61482aa2830d0ab2ad5af10b7250da9033ddcef0' Jul 15 13:05:38 np0000005197 kernel: Loaded X.509 cert 'Canonical Ltd. Secure Boot Signing (2017): 242ade75ac4a15e50d50c84b0d45ff3eae707a03' Jul 15 13:05:38 np0000005197 kernel: Loaded X.509 cert 'Canonical Ltd. Secure Boot Signing (ESM 2018): 365188c1d374d6b07c3c8f240f8ef722433d6a8b' Jul 15 13:05:38 np0000005197 kernel: Loaded X.509 cert 'Canonical Ltd. Secure Boot Signing (2019): c0746fd6c5da3ae827864651ad66ae47fe24b3e8' Jul 15 13:05:38 np0000005197 kernel: Loaded X.509 cert 'Canonical Ltd. Secure Boot Signing (2021 v1): a8d54bbb3825cfb94fa13c9f8a594a195c107b8d' Jul 15 13:05:38 np0000005197 kernel: Loaded X.509 cert 'Canonical Ltd. Secure Boot Signing (2021 v2): 4cf046892d6fd3c9a5b03f98d845f90851dc6a8c' Jul 15 13:05:38 np0000005197 kernel: Loaded X.509 cert 'Canonical Ltd. Secure Boot Signing (2021 v3): 100437bb6de6e469b581e61cd66bce3ef4ed53af' Jul 15 13:05:38 np0000005197 kernel: Loaded X.509 cert 'Canonical Ltd. Secure Boot Signing (Ubuntu Core 2019): c1d57b8f6b743f23ee41f4f7ee292f06eecadfb9' Jul 15 13:05:38 np0000005197 kernel: Key type .fscrypt registered Jul 15 13:05:38 np0000005197 kernel: Key type fscrypt-provisioning registered Jul 15 13:05:38 np0000005197 kernel: cryptd: max_cpu_qlen set to 1000 Jul 15 13:05:38 np0000005197 kernel: AVX2 version of gcm_enc/dec engaged. Jul 15 13:05:38 np0000005197 kernel: AES CTR mode by8 optimization enabled Jul 15 13:05:38 np0000005197 kernel: Key type encrypted registered Jul 15 13:05:38 np0000005197 kernel: AppArmor: AppArmor sha256 policy hashing enabled Jul 15 13:05:38 np0000005197 kernel: ima: No TPM chip found, activating TPM-bypass! Jul 15 13:05:38 np0000005197 kernel: Loading compiled-in module X.509 certificates Jul 15 13:05:38 np0000005197 kernel: Loaded X.509 cert 'Build time autogenerated kernel key: 79aab6b364387381d7a5d225dcfcd094a654ef62' Jul 15 13:05:38 np0000005197 kernel: ima: Allocated hash algorithm: sha256 Jul 15 13:05:38 np0000005197 kernel: ima: No architecture policies found Jul 15 13:05:38 np0000005197 kernel: evm: Initialising EVM extended attributes: Jul 15 13:05:38 np0000005197 kernel: evm: security.selinux Jul 15 13:05:38 np0000005197 kernel: evm: security.SMACK64 Jul 15 13:05:38 np0000005197 kernel: evm: security.SMACK64EXEC Jul 15 13:05:38 np0000005197 kernel: evm: security.SMACK64TRANSMUTE Jul 15 13:05:38 np0000005197 kernel: evm: security.SMACK64MMAP Jul 15 13:05:38 np0000005197 kernel: evm: security.apparmor Jul 15 13:05:38 np0000005197 kernel: evm: security.ima Jul 15 13:05:38 np0000005197 kernel: evm: security.capability Jul 15 13:05:38 np0000005197 kernel: evm: HMAC attrs: 0x1 Jul 15 13:05:38 np0000005197 kernel: PM: Magic number: 2:26:79 Jul 15 13:05:38 np0000005197 kernel: RAS: Correctable Errors collector initialized. Jul 15 13:05:38 np0000005197 kernel: clk: Disabling unused clocks Jul 15 13:05:38 np0000005197 kernel: Freeing unused decrypted memory: 2028K Jul 15 13:05:38 np0000005197 kernel: Freeing unused kernel image (initmem) memory: 4924K Jul 15 13:05:38 np0000005197 kernel: Write protecting the kernel read-only data: 38912k Jul 15 13:05:38 np0000005197 kernel: Freeing unused kernel image (rodata/data gap) memory: 1964K Jul 15 13:05:38 np0000005197 kernel: x86/mm: Checked W+X mappings: passed, no W+X pages found. Jul 15 13:05:38 np0000005197 kernel: Run /init as init process Jul 15 13:05:38 np0000005197 kernel: with arguments: Jul 15 13:05:38 np0000005197 kernel: /init Jul 15 13:05:38 np0000005197 kernel: nofb Jul 15 13:05:38 np0000005197 kernel: with environment: Jul 15 13:05:38 np0000005197 kernel: HOME=/ Jul 15 13:05:38 np0000005197 kernel: TERM=linux Jul 15 13:05:38 np0000005197 kernel: vga=normal Jul 15 13:05:38 np0000005197 kernel: usb 1-1: new full-speed USB device number 2 using uhci_hcd Jul 15 13:05:38 np0000005197 kernel: usb 1-1: New USB device found, idVendor=0627, idProduct=0001, bcdDevice= 0.00 Jul 15 13:05:38 np0000005197 kernel: usb 1-1: New USB device strings: Mfr=1, Product=3, SerialNumber=10 Jul 15 13:05:38 np0000005197 kernel: usb 1-1: Product: QEMU USB Tablet Jul 15 13:05:38 np0000005197 kernel: usb 1-1: Manufacturer: QEMU Jul 15 13:05:38 np0000005197 kernel: usb 1-1: SerialNumber: 28754-0000:00:02.0:00.0:01.0-1 Jul 15 13:05:38 np0000005197 kernel: virtio_net virtio1 enp3s0: renamed from eth0 Jul 15 13:05:38 np0000005197 kernel: virtio_gpu: probe of virtio0 failed with error -22 Jul 15 13:05:38 np0000005197 kernel: virtio_net virtio6 enp8s0: renamed from eth2 Jul 15 13:05:38 np0000005197 kernel: ahci 0000:00:1f.2: version 3.0 Jul 15 13:05:38 np0000005197 kernel: ACPI: \_SB_.GSIA: Enabled at IRQ 16 Jul 15 13:05:38 np0000005197 kernel: input: VirtualPS/2 VMware VMMouse as /devices/platform/i8042/serio1/input/input4 Jul 15 13:05:38 np0000005197 kernel: ahci 0000:00:1f.2: AHCI 0001.0000 32 slots 6 ports 1.5 Gbps 0x3f impl SATA mode Jul 15 13:05:38 np0000005197 kernel: ahci 0000:00:1f.2: flags: 64bit ncq only Jul 15 13:05:38 np0000005197 kernel: input: VirtualPS/2 VMware VMMouse as /devices/platform/i8042/serio1/input/input3 Jul 15 13:05:38 np0000005197 kernel: virtio_net virtio7 enp9s0: renamed from eth3 Jul 15 13:05:38 np0000005197 kernel: scsi host1: ahci Jul 15 13:05:38 np0000005197 kernel: scsi host2: ahci Jul 15 13:05:38 np0000005197 kernel: hid: raw HID events driver (C) Jiri Kosina Jul 15 13:05:38 np0000005197 kernel: scsi host3: ahci Jul 15 13:05:38 np0000005197 kernel: scsi host4: ahci Jul 15 13:05:38 np0000005197 kernel: scsi host5: ahci Jul 15 13:05:38 np0000005197 kernel: scsi host6: ahci Jul 15 13:05:38 np0000005197 kernel: ata1: SATA max UDMA/133 abar m4096@0xfea22000 port 0xfea22100 irq 76 lpm-pol 0 Jul 15 13:05:38 np0000005197 kernel: ata2: SATA max UDMA/133 abar m4096@0xfea22000 port 0xfea22180 irq 76 lpm-pol 0 Jul 15 13:05:38 np0000005197 kernel: ata3: SATA max UDMA/133 abar m4096@0xfea22000 port 0xfea22200 irq 76 lpm-pol 0 Jul 15 13:05:38 np0000005197 kernel: ata4: SATA max UDMA/133 abar m4096@0xfea22000 port 0xfea22280 irq 76 lpm-pol 0 Jul 15 13:05:38 np0000005197 kernel: usbcore: registered new interface driver usbhid Jul 15 13:05:38 np0000005197 kernel: ata5: SATA max UDMA/133 abar m4096@0xfea22000 port 0xfea22300 irq 76 lpm-pol 0 Jul 15 13:05:38 np0000005197 kernel: usbhid: USB HID core driver Jul 15 13:05:38 np0000005197 kernel: ata6: SATA max UDMA/133 abar m4096@0xfea22000 port 0xfea22380 irq 76 lpm-pol 0 Jul 15 13:05:38 np0000005197 kernel: virtio_net virtio5 enp7s0: renamed from eth1 Jul 15 13:05:38 np0000005197 kernel: input: QEMU QEMU USB Tablet as /devices/pci0000:00/0000:00:02.0/0000:01:00.0/0000:02:01.0/usb1/1-1/1-1:1.0/0003:0627:0001.0001/input/input5 Jul 15 13:05:38 np0000005197 kernel: hid-generic 0003:0627:0001.0001: input,hidraw0: USB HID v0.01 Mouse [QEMU QEMU USB Tablet] on usb-0000:02:01.0-1/input0 Jul 15 13:05:38 np0000005197 kernel: virtio_net virtio9 enp11s0: renamed from eth5 Jul 15 13:05:38 np0000005197 kernel: virtio_net virtio8 enp10s0: renamed from eth4 Jul 15 13:05:38 np0000005197 kernel: ata1: SATA link down (SStatus 0 SControl 300) Jul 15 13:05:38 np0000005197 kernel: ata2: SATA link down (SStatus 0 SControl 300) Jul 15 13:05:38 np0000005197 kernel: ata6: SATA link down (SStatus 0 SControl 300) Jul 15 13:05:38 np0000005197 kernel: ata5: SATA link down (SStatus 0 SControl 300) Jul 15 13:05:38 np0000005197 kernel: ata3: SATA link down (SStatus 0 SControl 300) Jul 15 13:05:38 np0000005197 kernel: ata4: SATA link down (SStatus 0 SControl 300) Jul 15 13:05:38 np0000005197 kernel: raid6: avx2x4 gen() 27735 MB/s Jul 15 13:05:38 np0000005197 kernel: raid6: avx2x2 gen() 27665 MB/s Jul 15 13:05:38 np0000005197 kernel: raid6: avx2x1 gen() 15732 MB/s Jul 15 13:05:38 np0000005197 kernel: raid6: using algorithm avx2x4 gen() 27735 MB/s Jul 15 13:05:38 np0000005197 kernel: raid6: .... xor() 5013 MB/s, rmw enabled Jul 15 13:05:38 np0000005197 kernel: raid6: using avx2x2 recovery algorithm Jul 15 13:05:38 np0000005197 kernel: xor: automatically using best checksumming function avx Jul 15 13:05:38 np0000005197 kernel: async_tx: api initialized (async) Jul 15 13:05:38 np0000005197 kernel: Btrfs loaded, zoned=yes, fsverity=yes Jul 15 13:05:38 np0000005197 kernel: EXT4-fs (sda1): mounted filesystem 8515de1c-ba7e-467b-adde-6d9f8a8dbc1f ro with ordered data mode. Quota mode: none. Jul 15 13:05:38 np0000005197 kernel: Cgroup memory moving (move_charge_at_immigrate) is deprecated. Please report your usecase to linux-mm@kvack.org if you depend on this functionality. Jul 15 13:05:38 np0000005197 kernel: Key type psk registered Jul 15 13:05:38 np0000005197 kernel: EXT4-fs (sda1): re-mounted 8515de1c-ba7e-467b-adde-6d9f8a8dbc1f r/w. Jul 15 13:05:38 np0000005197 kernel: storpool_rdma: loading out-of-tree module taints kernel. Jul 15 13:05:38 np0000005197 kernel: storpool_rdma: module verification failed: signature and/or required key missing - tainting kernel Jul 15 13:05:38 np0000005197 kernel: storpool_rdma: timeInit: tscPerUsec: 2395 Jul 15 13:05:38 np0000005197 kernel: virtio_net virtio8 sp0: renamed from enp10s0 Jul 15 13:05:38 np0000005197 kernel: virtio_net virtio6 iscsi1: renamed from enp8s0 Jul 15 13:05:38 np0000005197 kernel: virtio_net virtio5 iscsi0: renamed from enp7s0 Jul 15 13:05:38 np0000005197 kernel: virtio_net virtio7 sp-api: renamed from enp9s0 Jul 15 13:05:38 np0000005197 kernel: virtio_net virtio9 sp1: renamed from enp11s0 Jul 15 13:05:38 np0000005197 kernel: EXT4-fs (sda16): mounted filesystem 7dc15ce9-d090-44d7-bb05-2a36d545a8e3 r/w with ordered data mode. Quota mode: none. Jul 15 13:05:38 np0000005197 kernel: kvm_amd: TSC scaling supported Jul 15 13:05:38 np0000005197 kernel: kvm_amd: Nested Virtualization enabled Jul 15 13:05:38 np0000005197 kernel: kvm_amd: Nested Paging enabled Jul 15 13:05:38 np0000005197 kernel: kvm_amd: LBR virtualization supported Jul 15 13:05:38 np0000005197 kernel: kvm_amd: Virtual VMLOAD VMSAVE supported Jul 15 13:05:38 np0000005197 kernel: kvm_amd: Virtual GIF supported Jul 15 13:05:38 np0000005197 kernel: audit: type=1400 audit(1784120738.757:2): apparmor="STATUS" operation="profile_load" profile="unconfined" name="ch-run" pid=1097 comm="apparmor_parser" Jul 15 13:05:38 np0000005197 kernel: audit: type=1400 audit(1784120738.757:3): apparmor="STATUS" operation="profile_load" profile="unconfined" name="buildah" pid=1093 comm="apparmor_parser" Jul 15 13:05:38 np0000005197 kernel: audit: type=1400 audit(1784120738.757:4): apparmor="STATUS" operation="profile_load" profile="unconfined" name="Discord" pid=1088 comm="apparmor_parser" Jul 15 13:05:38 np0000005197 kernel: audit: type=1400 audit(1784120738.757:5): apparmor="STATUS" operation="profile_load" profile="unconfined" name="balena-etcher" pid=1091 comm="apparmor_parser" Jul 15 13:05:38 np0000005197 kernel: audit: type=1400 audit(1784120738.757:6): apparmor="STATUS" operation="profile_load" profile="unconfined" name="QtWebEngineProcess" pid=1090 comm="apparmor_parser" Jul 15 13:05:38 np0000005197 kernel: audit: type=1400 audit(1784120738.757:7): apparmor="STATUS" operation="profile_load" profile="unconfined" name=4D6F6E676F444220436F6D70617373 pid=1089 comm="apparmor_parser" Jul 15 13:05:38 np0000005197 kernel: audit: type=1400 audit(1784120738.757:8): apparmor="STATUS" operation="profile_load" profile="unconfined" name="busybox" pid=1094 comm="apparmor_parser" Jul 15 13:05:38 np0000005197 kernel: audit: type=1400 audit(1784120738.757:9): apparmor="STATUS" operation="profile_load" profile="unconfined" name="cam" pid=1095 comm="apparmor_parser" Jul 15 13:05:38 np0000005197 kernel: audit: type=1400 audit(1784120738.758:10): apparmor="STATUS" operation="profile_load" profile="unconfined" name="chrome" pid=1098 comm="apparmor_parser" Jul 15 13:05:43 np0000005197 kernel: kauditd_printk_skb: 112 callbacks suppressed Jul 15 13:05:43 np0000005197 kernel: audit: type=1400 audit(1784120743.415:123): apparmor="STATUS" operation="profile_replace" info="same as current profile, skipping" profile="unconfined" name="rsyslogd" pid=4969 comm="apparmor_parser" Jul 15 13:05:43 np0000005197 kernel: loop0: detected capacity change from 0 to 8 Jul 15 13:05:43 np0000005197 kernel: audit: type=1400 audit(1784120743.649:124): apparmor="STATUS" operation="profile_replace" profile="unconfined" name="/usr/lib/snapd/snap-confine" pid=5144 comm="apparmor_parser" Jul 15 13:05:43 np0000005197 kernel: audit: type=1400 audit(1784120743.656:125): apparmor="STATUS" operation="profile_replace" profile="unconfined" name="/usr/lib/snapd/snap-confine//mount-namespace-capture-helper" pid=5144 comm="apparmor_parser" Jul 15 13:06:30 np0000005197 sudo[5353]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-bkoyeedzdckdxvoncvtevzmhawvcgxqy ; cat /proc/sys/kernel/random/boot_id' Jul 15 13:06:30 np0000005197 sudo[5353]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:06:30 np0000005197 sudo[5353]: pam_unix(sudo:session): session closed for user root Jul 15 13:06:35 np0000005197 sudo[5358]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-rkjyhjhzxcnvbbsiyldqqjnaejpinzdu ; whoami' Jul 15 13:06:35 np0000005197 sudo[5358]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:06:35 np0000005197 sudo[5358]: pam_unix(sudo:session): session closed for user root Jul 15 13:06:42 np0000005197 sudo[6191]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-yfzxrguiowjdkesmzybrecmpmzcvdsim ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120801.8204641-10817-225471125303947/AnsiballZ_ufw.py' Jul 15 13:06:42 np0000005197 sudo[6191]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:06:42 np0000005197 sudo[6191]: pam_unix(sudo:session): session closed for user root Jul 15 13:06:42 np0000005197 sudo[6235]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-moruhxffbfyzzudfaxdnnqqwenhhmyyi ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120802.6763892-10817-37065262076396/AnsiballZ_ufw.py' Jul 15 13:06:42 np0000005197 sudo[6235]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:06:43 np0000005197 sudo[6235]: pam_unix(sudo:session): session closed for user root Jul 15 13:06:43 np0000005197 sudo[6275]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-jsvuuarinkjxdwjfqrfldirusazamvkk ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120803.2859354-10817-204845767244844/AnsiballZ_ufw.py' Jul 15 13:06:43 np0000005197 sudo[6275]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:06:43 np0000005197 sudo[6275]: pam_unix(sudo:session): session closed for user root Jul 15 13:06:44 np0000005197 sudo[6394]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-gygpvairxoxduxtphmjgfbykkbtfqngq ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120804.6442487-10847-123762591644776/AnsiballZ_command.py' Jul 15 13:06:44 np0000005197 sudo[6394]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:06:44 np0000005197 sudo[6394]: pam_unix(sudo:session): session closed for user root Jul 15 13:06:45 np0000005197 sudo[6417]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-awvjlbmaibtiecuxumuohepmrppfvrdu ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120805.4697473-10860-25508839202675/AnsiballZ_command.py' Jul 15 13:06:45 np0000005197 sudo[6417]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:06:46 np0000005197 sudo[6417]: pam_unix(sudo:session): session closed for user root Jul 15 13:06:46 np0000005197 sudo[6449]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-qlezsgruatsadyqgaqyvyiskwuptyvnx ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120806.3026414-10869-165093370391216/AnsiballZ_service_facts.py' Jul 15 13:06:46 np0000005197 sudo[6449]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:06:49 np0000005197 sudo[6449]: pam_unix(sudo:session): session closed for user root Jul 15 13:06:50 np0000005197 sudo[7047]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-gxyjxiqofkpduihpfahrthqibfjkbpxj ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120810.4576747-10887-193873619906781/AnsiballZ_file.py' Jul 15 13:06:50 np0000005197 sudo[7047]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:06:50 np0000005197 sudo[7047]: pam_unix(sudo:session): session closed for user root Jul 15 13:06:50 np0000005197 sudo[7065]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-zobemwbapremvxylfhwuzagmbntfxyhe ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120810.8364685-10895-167585167823903/AnsiballZ_systemd.py' Jul 15 13:06:50 np0000005197 sudo[7065]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:06:51 np0000005197 sudo[7065]: pam_unix(sudo:session): session closed for user root Jul 15 13:06:51 np0000005197 sudo[7084]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-gqwwqjfbuvjrqsnjshrxrvglpbiysfll ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120811.381102-10904-22509927920334/AnsiballZ_command.py' Jul 15 13:06:51 np0000005197 sudo[7084]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:06:51 np0000005197 sudo[7084]: pam_unix(sudo:session): session closed for user root Jul 15 13:06:51 np0000005197 sudo[7107]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-tqmxgfnzyfqbezgaboftptvnvjwislyq ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120811.9378552-10913-20060313315096/AnsiballZ_stat.py' Jul 15 13:06:51 np0000005197 sudo[7107]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:06:52 np0000005197 sudo[7107]: pam_unix(sudo:session): session closed for user root Jul 15 13:06:52 np0000005197 sudo[7118]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-cuwsycqmasuorwyrxasirezsevrhecgh ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120811.9378552-10913-20060313315096/AnsiballZ_copy.py' Jul 15 13:06:52 np0000005197 sudo[7118]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:06:52 np0000005197 sudo[7118]: pam_unix(sudo:session): session closed for user root Jul 15 13:06:52 np0000005197 sudo[7136]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-oullqozoiulxhagsctwydqaumfgplcwm ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120812.5829408-10928-212438340293700/AnsiballZ_copy.py' Jul 15 13:06:52 np0000005197 sudo[7136]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:06:52 np0000005197 sudo[7136]: pam_unix(sudo:session): session closed for user root Jul 15 13:06:53 np0000005197 sudo[7177]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-waquaafgczztjzeflsggiwbrcllzcigx ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120813.5330184-10951-7677749411761/AnsiballZ_slurp.py' Jul 15 13:06:53 np0000005197 sudo[7177]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:06:53 np0000005197 sudo[7177]: pam_unix(sudo:session): session closed for user root Jul 15 13:06:54 np0000005197 sudo[7195]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-ogbofflelqgwuhsdvckndhzmzfrjhdtl ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120814.1538532-10962-196949880549486/AnsiballZ_command.py' Jul 15 13:06:54 np0000005197 sudo[7195]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:06:55 np0000005197 kernel: sdb: sdb1 Jul 15 13:06:58 np0000005197 sudo[7195]: pam_unix(sudo:session): session closed for user root Jul 15 13:06:58 np0000005197 sudo[7261]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-johtxdvrbazphymeqtqmbzklyiqbmhuy ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120818.2611866-10970-105693156634490/AnsiballZ_systemd.py' Jul 15 13:06:58 np0000005197 sudo[7261]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:06:58 np0000005197 sudo[7261]: pam_unix(sudo:session): session closed for user root Jul 15 13:06:58 np0000005197 sudo[7295]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-cbnylgmnpqmhnlbkzuhzmvtbxrwxxllq ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120818.8609238-10979-163204375548491/AnsiballZ_stat.py' Jul 15 13:06:58 np0000005197 sudo[7295]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:06:59 np0000005197 sudo[7295]: pam_unix(sudo:session): session closed for user root Jul 15 13:06:59 np0000005197 sudo[7306]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-ohdtaeubnmiqdsrbykhwetvlwtgemmcz ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120818.8609238-10979-163204375548491/AnsiballZ_copy.py' Jul 15 13:06:59 np0000005197 sudo[7306]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:06:59 np0000005197 sudo[7306]: pam_unix(sudo:session): session closed for user root Jul 15 13:06:59 np0000005197 sudo[7324]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-unaqreklfqfljauclcfdbydywrdngibi ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120819.5698543-10996-156997527901285/AnsiballZ_stat.py' Jul 15 13:06:59 np0000005197 sudo[7324]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:06:59 np0000005197 sudo[7324]: pam_unix(sudo:session): session closed for user root Jul 15 13:07:00 np0000005197 sudo[7359]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-cweoafmgxtylkieviaidityykklajphj ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120820.3199909-11014-77013085224742/AnsiballZ_command.py' Jul 15 13:07:00 np0000005197 sudo[7359]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:07:00 np0000005197 sudo[7359]: pam_unix(sudo:session): session closed for user root Jul 15 13:07:00 np0000005197 sudo[7382]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-hyrlwlnsopmevsgbzwpxaosbxnbzazxd ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120820.7937353-11026-241606900987489/AnsiballZ_command.py' Jul 15 13:07:00 np0000005197 sudo[7382]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:07:04 np0000005197 sudo[7382]: pam_unix(sudo:session): session closed for user root Jul 15 13:07:04 np0000005197 sudo[7412]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-ahmkaabfnyvwjcqxacitivlmkunvugkg ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120824.4685454-11035-95097250752905/AnsiballZ_systemd.py' Jul 15 13:07:04 np0000005197 sudo[7412]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:07:04 np0000005197 sudo[7412]: pam_unix(sudo:session): session closed for user root Jul 15 13:07:05 np0000005197 sudo[7432]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-hmkvabenjfjuforcuoeswdvsbnnxdvrz ; CGCONFIG_FORCE_STARTUP=1 /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120825.0190759-11044-172734466513552/AnsiballZ_command.py' Jul 15 13:07:05 np0000005197 sudo[7432]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:07:05 np0000005197 sudo[7432]: pam_unix(sudo:session): session closed for user root Jul 15 13:07:07 np0000005197 sudo[7658]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-nwfjmromvvxtdfruhnbjjrcjknkzvoij ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120827.6983573-11078-18703666367894/AnsiballZ_command.py' Jul 15 13:07:07 np0000005197 sudo[7658]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:07:08 np0000005197 sudo[7658]: pam_unix(sudo:session): session closed for user root Jul 15 13:07:08 np0000005197 sudo[7683]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-kzdmdcwkzsjghkwnkwdlshfizwvqgsiu ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120828.2969418-11086-227861264986933/AnsiballZ_command.py' Jul 15 13:07:08 np0000005197 sudo[7683]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:07:09 np0000005197 sudo[7683]: pam_unix(sudo:session): session closed for user root Jul 15 13:07:09 np0000005197 sudo[7833]: ubuntu : TTY=pts/0 ; PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-pepetvmpvjjdrxbwvcqqzyldllhnijft ; /usr/bin/python3.12 /home/ubuntu/.ansible/tmp/ansible-tmp-1784120829.585577-11094-111231963195275/AnsiballZ_command.py' Jul 15 13:07:09 np0000005197 sudo[7833]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:07:11 np0000005197 kernel: storpool_pci 0000:07:00.0: probing Jul 15 13:07:11 np0000005197 kernel: storpool_pci 0000:07:00.0: device registered, physDev 0000:07:00.0 Jul 15 13:07:11 np0000005197 kernel: storpool_pci 0000:08:00.0: probing Jul 15 13:07:11 np0000005197 kernel: storpool_pci 0000:08:00.0: device registered, physDev 0000:08:00.0 Jul 15 13:07:11 np0000005197 kernel: storpool_bd: timeInit: tscPerUsec: 2395 Jul 15 13:07:12 np0000005197 sudo[7833]: pam_unix(sudo:session): session closed for user root Jul 15 13:07:12 np0000005197 kernel: block sdb: the capability attribute has been deprecated. Jul 15 13:07:12 np0000005197 kernel: storpool_disk: closeDisk: service 8078: disk sda closed Jul 15 13:07:14 np0000005197 sudo[8488]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-gstefejwghqcsypluhsuktdratccbehv ; /usr/bin/python3' Jul 15 13:07:14 np0000005197 sudo[8488]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:07:14 np0000005197 sudo[8488]: pam_unix(sudo:session): session closed for user root Jul 15 13:07:15 np0000005197 sudo[8571]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-efvudammxfpqpqryyjiuzxtseyptnaat ; /usr/bin/python3' Jul 15 13:07:15 np0000005197 sudo[8571]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:07:15 np0000005197 sudo[8571]: pam_unix(sudo:session): session closed for user root Jul 15 13:07:16 np0000005197 kernel: virtio_net virtio7 sp-api: entered promiscuous mode Jul 15 13:07:16 np0000005197 kernel: virtio_net virtio7 sp-api: left promiscuous mode Jul 15 13:07:16 np0000005197 kernel: virtio_net virtio7 sp-api: entered promiscuous mode Jul 15 13:07:16 np0000005197 kernel: virtio_net virtio7 sp-api: left promiscuous mode Jul 15 13:07:16 np0000005197 kernel: virtio_net virtio7 sp-api: entered promiscuous mode Jul 15 13:07:16 np0000005197 kernel: virtio_net virtio7 sp-api: left promiscuous mode Jul 15 13:07:16 np0000005197 kernel: virtio_net virtio7 sp-api: entered promiscuous mode Jul 15 13:07:16 np0000005197 kernel: virtio_net virtio7 sp-api: left promiscuous mode Jul 15 13:07:16 np0000005197 kernel: virtio_net virtio7 sp-api: entered promiscuous mode Jul 15 13:07:16 np0000005197 kernel: virtio_net virtio7 sp-api: left promiscuous mode Jul 15 13:07:16 np0000005197 kernel: virtio_net virtio7 sp-api: entered promiscuous mode Jul 15 13:07:16 np0000005197 kernel: virtio_net virtio7 sp-api: left promiscuous mode Jul 15 13:07:16 np0000005197 sudo[8590]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-eocxzypyrcffgcxsbopiiahklqzbizxu ; /usr/bin/python3' Jul 15 13:07:16 np0000005197 sudo[8590]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:07:17 np0000005197 sudo[8590]: pam_unix(sudo:session): session closed for user root Jul 15 13:07:17 np0000005197 sudo[8604]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-gchdthfbkuevkqplrnfobgviolptivdq ; /usr/bin/python3' Jul 15 13:07:17 np0000005197 sudo[8604]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:07:17 np0000005197 sudo[8604]: pam_unix(sudo:session): session closed for user root Jul 15 13:07:17 np0000005197 sudo[8637]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-fsmhutqdjxvjxksuarsjvwxneuguumzd ; /usr/bin/python3' Jul 15 13:07:17 np0000005197 sudo[8637]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:07:17 np0000005197 sudo[8637]: pam_unix(sudo:session): session closed for user root Jul 15 13:07:18 np0000005197 sudo[8650]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-leuddjaqkggizpskfudibtahzjdsxbhq ; /usr/bin/python3' Jul 15 13:07:18 np0000005197 sudo[8650]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:07:18 np0000005197 sudo[8650]: pam_unix(sudo:session): session closed for user root Jul 15 13:07:18 np0000005197 sudo[8663]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-efenccdfklxmbqtwxmgtzsajiwsdpwzl ; /usr/bin/python3' Jul 15 13:07:18 np0000005197 sudo[8663]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:07:18 np0000005197 sudo[8663]: pam_unix(sudo:session): session closed for user root Jul 15 13:07:18 np0000005197 sudo[8689]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-repoadasvrkewcrkmjafvanyizxtxejx ; /usr/bin/python3' Jul 15 13:07:18 np0000005197 sudo[8689]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:07:19 np0000005197 sudo[8689]: pam_unix(sudo:session): session closed for user root Jul 15 13:07:19 np0000005197 sudo[8700]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-xuwnezmqlmephsbqgwsqkxfhxkrymxso ; /usr/bin/python3' Jul 15 13:07:19 np0000005197 sudo[8700]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:07:19 np0000005197 sudo[8700]: pam_unix(sudo:session): session closed for user root Jul 15 13:07:19 np0000005197 sudo[8713]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-ngaisjhzuzibskswgnrlskzwlpahufzj ; /usr/bin/python3' Jul 15 13:07:19 np0000005197 sudo[8713]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:07:19 np0000005197 sudo[8713]: pam_unix(sudo:session): session closed for user root Jul 15 13:07:19 np0000005197 sudo[8743]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-ikvuqfqxacomnewckomkmhgbuzejllcq ; /usr/bin/python3' Jul 15 13:07:19 np0000005197 sudo[8743]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:07:20 np0000005197 sudo[8743]: pam_unix(sudo:session): session closed for user root Jul 15 13:07:20 np0000005197 sudo[8754]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-caopjvjmbmatucmnfrbieppmtwjadymk ; /usr/bin/python3' Jul 15 13:07:20 np0000005197 sudo[8754]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:07:20 np0000005197 sudo[8754]: pam_unix(sudo:session): session closed for user root Jul 15 13:50:37 np0000005197 kernel: storpool_rdma: netdevNotifier: our interface sp0 is going down! Jul 15 13:50:37 np0000005197 kernel: storpool_rdma: netdevNotifier: our interface sp0 is going down! Jul 15 13:50:39 np0000005197 kernel: storpool_rdma: netdevNotifier: our interface sp1 is going down! Jul 15 13:50:39 np0000005197 kernel: storpool_rdma: netdevNotifier: our interface sp1 is going down! Jul 15 13:51:00 np0000005197 kernel: sd 0:0:0:1: [sdb] Synchronizing SCSI cache Jul 15 13:51:00 np0000005197 kernel: sd 0:0:0:1: LUN assignments on this target have changed. The Linux SCSI layer does not automatically remap LUN assignments. Jul 15 13:51:00 np0000005197 kernel: sd 0:0:0:1: [sdb] Synchronize Cache(10) failed: Result: hostbyte=DID_OK driverbyte=DRIVER_OK Jul 15 13:51:00 np0000005197 kernel: sd 0:0:0:1: [sdb] Sense Key : Illegal Request [current] Jul 15 13:51:00 np0000005197 kernel: sd 0:0:0:1: [sdb] Add. Sense: Logical unit not supported Jul 15 13:51:33 np0000005197 sudo[19988]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-afhfwuwkpqtefymyzionktckzbizndio ; /usr/bin/python3' Jul 15 13:51:33 np0000005197 sudo[19988]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:51:33 np0000005197 sudo[19988]: pam_unix(sudo:session): session closed for user root Jul 15 13:51:34 np0000005197 sudo[19996]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-wbiozizqpmlwwrbwestrlzsdjiqdzmga ; /usr/bin/python3' Jul 15 13:51:34 np0000005197 sudo[19996]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000) Jul 15 13:51:35 np0000005197 sudo[19996]: pam_unix(sudo:session): session closed for user root Jul 15 13:51:49 np0000005197 sudo[20066]: ubuntu : PWD=/home/ubuntu ; USER=root ; COMMAND=/bin/sh -c 'echo BECOME-SUCCESS-nheolclladcxctdnyzimidlikblgjxuk ; /usr/bin/python3' Jul 15 13:51:49 np0000005197 sudo[20066]: pam_unix(sudo:session): session opened for user root(uid=0) by ubuntu(uid=1000)